ERCC6L Polyclonal antibody 15688-1-AP proteintech
$149.00
In stock
SKU
15688-1-AP
| Catalog Number | 15688-1-AP |
| Synonyms | Tumor antigen BJ HCC 15, PLK1-interacting checkpoint helicase, PICH, EC:3.6.4.12, DNA excision repair protein ERCC-6-like |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, human heart tissue, Jurkat cells, mouse lung tissue, K-562 cells, U2OS cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, human heart tissue, Jurkat cells, mouse lung tissue, K-562 cells, U2OS cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8223 Product name: Recombinant human ERCC6L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-454 aa of BC008808 Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN Predict reactive species |
| Full Name | excision repair cross-complementing rodent repair deficiency, complementation group 6-like |
| Calculated Molecular Weight | 419 aa, 46 kDa, 141 kDa |
| Observed Molecular Weight | 180 kDa |
| GenBank Accession Number | BC008808 |
| Gene Symbol | ERCC6L |
| Gene ID (NCBI) | 54821 |
| RRID | AB_2098171 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q2NKX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ERCC6L antibody 15688-1-AP | Download protocol |
| WB protocol for ERCC6L antibody 15688-1-AP | Download protocol |
| human | IHC Front Genet Prognostic and tumor microenvironmental features of gastric cancer revealed by macrophage polarization and protein lactylation-related genes Authors - Zifan Xu View Article |
| human,mouse | WB J Ethnopharmacol Gypenoside LI arrests the cell cycle of breast cancer in G0/G1 phase by down-regulating E2F1. Authors - Ma-Li Zu View Article |
| Citations | 11 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa. Protocols Product Specific Protocols IHC protocol for ERCC6L antibody 15688-1-AP Download protocol WB protocol for ERCC6L antibody 15688-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- ERCC6L-mediated stabilization of HIF-1α enhances glycolysis and stemness properties of lung adenocarcinoma cells
Journal: Cell Death Dis | Authors: Zhimin Lu KD Validated - Potential 'anti-cancer' effects of esketamine on proliferation, apoptosis, migration and invasion in esophageal squamous carcinoma cells
Journal: Eur J Med Res | Authors: Chao Li | Species: human | Application: WB - Gypenoside LI arrests the cell cycle of breast cancer in G0/G1 phase by down-regulating E2F1.
Journal: J Ethnopharmacol | Authors: Ma-Li Zu | Species: human,mouse | Application: WB - Overexpression of ERCC6L correlates with poor prognosis and confers malignant phenotypes of lung adenocarcinoma.
Journal: Oncol Rep | Authors: Xiaoyue Huang | Species: human | Application: WB - ERCC6L promotes the progression of hepatocellular carcinoma through activating PI3K/AKT and NF-κB signaling pathway.
Journal: BMC Cancer | Authors: Han Chen KD Validated | Species: human | Application: WB - Prognostic and tumor microenvironmental features of gastric cancer revealed by macrophage polarization and protein lactylation-related genes
Journal: Front Genet | Authors: Zifan Xu | Species: human | Application: IHC - Overexpression of ERCC6L correlates with poor prognosis and confers malignant phenotypes of lung adenocarcinoma.
Journal: Oncol Rep | Authors: Xiaoyue Huang | Species: human | Application: WB - IGF2BP2 promotes ovarian cancer growth and metastasis by upregulating CKAP2L protein expression in an m6 A-dependent manner
Journal: FASEB J | Authors: Yaqian Shi | Species: human | Application: WB - ERCC6L promotes the progression of hepatocellular carcinoma through activating PI3K/AKT and NF-κB signaling pathway.
Journal: BMC Cancer | Authors: Han Chen | Species: human | Application: WB - Prognostic and tumor microenvironmental features of gastric cancer revealed by macrophage polarization and protein lactylation-related genes
Journal: Front Genet | Authors: Zifan Xu | Species: human | Application: IHC - ERCC6L promotes cell growth and invasion in human colorectal cancer.
Journal: Oncol Lett | Authors: Yang Xie | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
