ERH Polyclonal antibody 15974-1-AP proteintech
$149.00
In stock
SKU
15974-1-AP
| Catalog Number | 15974-1-AP |
| Synonyms | DROER |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, HEK-293 cells, mouse testis tissue, rat liver tissue, rat testis tissue |
| Tested Applications — Positive IHC detected in | mouse testis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse liver tissue, HEK-293 cells, mouse testis tissue, rat liver tissue, rat testis tissue |
| Positive IHC detected in | mouse testis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8761 Product name: Recombinant human ERH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014301 Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Predict reactive species |
| Full Name | enhancer of rudimentary homolog (Drosophila) |
| Calculated Molecular Weight | 104 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC014301 |
| Gene Symbol | ERH |
| Gene ID (NCBI) | 2079 |
| RRID | AB_2098556 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84090 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ERH antibody 15974-1-AP | Download protocol |
| WB protocol for ERH antibody 15974-1-AP | Download protocol |
| human, mouse | WB Acta Pharm Sin B Hepatic stellate cell enriched Asporin drives liver fibrosis by stabilizing ERH to promote IL-17/MAPK11 signaling. Authors - Jian Sun View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Novel stress granules-like structures are induced via a paracrine mechanism during viral infection.
Journal: J Cell Sci | Authors: Valentina Iadevaia | Application: IF - DGCR8 promotes nascent transcription independently of DROSHA.
Journal: Biochem Biophys Res Commun | Authors: Jin Wang - Hepatic stellate cell enriched Asporin drives liver fibrosis by stabilizing ERH to promote IL-17/MAPK11 signaling.
Journal: Acta Pharm Sin B | Authors: Jian Sun | Species: human, mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
