EVI5 Recombinant monoclonal antibody, PBS Only 84738-2-PBS proteintech
$699.00
In stock
SKU
84738-2-PBS
| Catalog Number | 84738-2-PBS |
| Synonyms | 241918D11, NB4S |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | IHC, IF/ICC, FC (Intra), Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag26739 Product name: Recombinant human EVI5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC156793 Sequence: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSP Predict reactive species |
| Full Name | ecotropic viral integration site 5 |
| Calculated Molecular Weight | 810 aa, 93 kDa |
| GenBank Accession Number | BC156793 |
| Gene Symbol | EVI5 |
| Gene ID (NCBI) | 7813 |
| RRID | AB_3672122 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | O60447 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241918D11 |
| Conjugation | Unconjugated |
EVI5 functions as a regulator of cell cycle progression by stabilizing the FBXO5 protein and promoting cyclin-A accumulation during interphase. It may play a role in cytokinesis (PMID: 16439210).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
