Caspase 7 Monoclonal antibody 67956-1-Ig proteintech
$149.00
In stock
SKU
67956-1-Ig
| Catalog Number | 67956-1-Ig |
| Synonyms | Apoptotic protease Mch 3, CASP 7, CASP7, Caspase 7, Caspase7, CMH 1, ICE LAP3, ICE like apoptotic protease 3, MCH3 |
| Host | Mouse |
| Reactivity | Human, mouse, rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | Jurkat cells, PC-12 cells, RAW 264.7 cells |
| Tested Applications — Positive IHC detected in | rat stomach tissue, human liver cancer tissue, mouse liver tissue, mouse stomach tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Positive WB detected in | Jurkat cells, PC-12 cells, RAW 264.7 cells |
| Positive IHC detected in | rat stomach tissue, human liver cancer tissue, mouse liver tissue, mouse stomach tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27601 Product name: Recombinant human Caspase 7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC015799 Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC Predict reactive species |
| Full Name | caspase 7, apoptosis-related cysteine peptidase |
| Calculated Molecular Weight | 303 aa, 34 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC015799 |
| Gene Symbol | Caspase 7 |
| Gene ID (NCBI) | 840 |
| RRID | AB_2918707 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P55210 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Caspase 7 antibody 67956-1-Ig | Download protocol |
| WB protocol for Caspase 7 antibody 67956-1-Ig | Download protocol |
| rat | WB J Nanobiotechnology Synergistic microenvironment therapy: a dual-function nanogel of supramolecular collagen ll-mimetic matrix and antioxidant MXene for attenuating intervertebral disc degeneration. Authors - Gan Lyu View Article |
| mouse | WB J Nanobiotechnology Low-dose X-ray-activated radiodynamic therapy via a lutetium-coordinated nanoplatform synergizing PARP inhibition and ferroptosis. Authors - Wanli Song View Article |
| Citations | 4 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:500-1:2000 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 3C9H4 |
| Conjugation | Unconjugated |
Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution. Protocols Product Specific Protocols IHC protocol for Caspase 7 antibody 67956-1-Ig Download protocol WB protocol for Caspase 7 antibody 67956-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Study on low concentration deltamethrin toxicity mediated by phospholipase D in Chinese mitten crab (Eriocheir sinensis) ovary
Journal: Aquat Toxicol | Authors: Qi Sun | Application: IF - Synergistic microenvironment therapy: a dual-function nanogel of supramolecular collagen ll-mimetic matrix and antioxidant MXene for attenuating intervertebral disc degeneration.
Journal: J Nanobiotechnology | Authors: Gan Lyu | Species: rat | Application: WB - Low-dose X-ray-activated radiodynamic therapy via a lutetium-coordinated nanoplatform synergizing PARP inhibition and ferroptosis.
Journal: J Nanobiotechnology | Authors: Wanli Song | Species: mouse | Application: WB - The pluripotent-to-totipotent state transition in mESCs activates the intrinsic apoptotic pathway through DUX-induced DNA replication stress
Journal: Cell Mol Life Sci | Authors: Shunze Jia | Application: WB
Reviews
Write Your Own Review