EXOC1 Polyclonal antibody 11690-1-AP proteintech
$149.00
In stock
SKU
11690-1-AP
| Catalog Number | 11690-1-AP |
| Synonyms | BM 102, Exocyst complex component 1, Exocyst complex component Sec3, SEC3, SEC3L1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, human brain tissue, mouse brain tissue, rat brain tissue, HeLa cells, C2C12 cells |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human placenta tissue |
| Tested Applications — Positive IF/ICC detected in | C2C12 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, human brain tissue, mouse brain tissue, rat brain tissue, HeLa cells, C2C12 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | C2C12 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2303 Product name: Recombinant human EXOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-488 aa of BC020650 Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH Predict reactive species |
| Full Name | exocyst complex component 1 |
| Calculated Molecular Weight | 894 aa, 102 kDa |
| Observed Molecular Weight | 102 kDa |
| GenBank Accession Number | BC020650 |
| Gene Symbol | EXOC1 |
| Gene ID (NCBI) | 55763 |
| RRID | AB_2231500 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NV70 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for EXOC1 antibody 11690-1-AP | Download protocol |
| IHC protocol for EXOC1 antibody 11690-1-AP | Download protocol |
| IP protocol for EXOC1 antibody 11690-1-AP | Download protocol |
| WB protocol for EXOC1 antibody 11690-1-AP | Download protocol |
| human | WB,IP Retrovirology Proteomic analysis of HIV-1 Nef cellular binding partners reveals a role for exocyst complex proteins in mediating enhancement of intercellular nanotube formation. Authors - Mukerji Joya J View Article |
| mouse | IF Elife EXOC1 plays an integral role in spermatogonia pseudopod elongation and spermatocyte stable syncytium formation in mice. Authors - Yuki Osawa View Article |
| Citations | 16 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF-P : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
EXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses. Protocols Product Specific Protocols IF protocol for EXOC1 antibody 11690-1-AP Download protocol IHC protocol for EXOC1 antibody 11690-1-AP Download protocol IP protocol for EXOC1 antibody 11690-1-AP Download protocol WB protocol for EXOC1 antibody 11690-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A phosphoinositide conversion mechanism for exit from endosomes.
Journal: Nature | Authors: Katharina Ketel KD Validated | Species: human | Application: WB - Intercellular nanotubes mediate mitochondrial trafficking between cancer and immune cells.
Journal: Nat Nanotechnol | Authors: Tanmoy Saha KD Validated | Species: human | Application: WB,IF - The exocyst controls lysosome secretion and antigen extraction at the immune synapse of B cells.
Journal: J Cell Biol | Authors: Juan José Sáez | Species: mouse | Application: WB - EXOC1 plays an integral role in spermatogonia pseudopod elongation and spermatocyte stable syncytium formation in mice.
Journal: Elife | Authors: Yuki Osawa | Species: mouse | Application: IF - Shigella hijacks the exocyst to cluster macropinosomes for efficient vacuolar escape.
Journal: PLoS Pathog | Authors: Yuen-Yan Chang | Species: human | Application: IF - Proteomic analysis of HIV-1 Nef cellular binding partners reveals a role for exocyst complex proteins in mediating enhancement of intercellular nanotube formation.
Journal: Retrovirology | Authors: Mukerji Joya J | Species: human | Application: WB,IP - Disrupted-in-schizophrenia-1 (DISC1) Regulates Endoplasmic Reticulum Calcium Dynamics.
Journal: Sci Rep | Authors: Sung Jin Park | Species: mouse | Application: WB,IF - Shigella hijacks the exocyst to cluster macropinosomes for efficient vacuolar escape.
Journal: PLoS Pathog | Authors: Yuen-Yan Chang | Species: human | Application: IF - The exocyst complex regulates insulin-stimulated glucose uptake of skeletal muscle cells
Journal: Am J Physiol Endocrinol Metab | Authors: Brent A Fujimoto | Species: rat | Application: WB,IF - Proteomic analysis of HIV-1 Nef cellular binding partners reveals a role for exocyst complex proteins in mediating enhancement of intercellular nanotube formation.
Journal: Retrovirology | Authors: Mukerji Joya J | Species: human | Application: WB,IP - EXO1 overexpression is associated with poor prognosis of hepatocellular carcinoma patients.
Journal: Cell Cycle | Authors: Yaoyao Dai | Species: human | Application: WB,IF - TNFAIP2 increases macrophage response to CSF-1 through multiple effects on CSF-1 receptor.
Journal: J Leukoc Biol | Authors: Randa A Abdelnaser | Species: human | Application: WB - Exocyst complex protein expression in the human placenta.
Journal: Placenta | Authors: I M Gonzalez | Species: human | Application: WB,IF - Syntaxin 16 is a master recruitment factor for cytokinesis.
Journal: Mol Biol Cell | Authors: Neto Hélia H | Species: human | Application: IF - EXOC1 plays an integral role in spermatogonia pseudopod elongation and spermatocyte stable syncytium formation in mice.
Journal: Elife | Authors: Yuki Osawa | Species: mouse | Application: IF - The exocyst is an insulin-sensitive regulator of amyloid precursor protein trafficking and amyloid-beta generation in neurons.
Journal: bioRxiv | Authors: Chantell Balaan | Species: human,mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
