EZH2 Recombinant monoclonal antibody, PBS Only (Detector) 84824-5-PBS proteintech
$699.00
In stock
SKU
84824-5-PBS
| Catalog Number | 84824-5-PBS |
| Synonyms | EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1, EZH1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag16789 Product name: Recombinant human EZH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-261 aa of BC010858 Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT Predict reactive species |
| Full Name | enhancer of zeste homolog 2 (Drosophila) |
| Calculated Molecular Weight | 751 aa, 86 kDa |
| GenBank Accession Number | BC010858 |
| Gene Symbol | EZH2 |
| Gene ID (NCBI) | 2146 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15910 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242309E8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
