Cytokeratin 15 Monoclonal antibody 60247-1-Ig proteintech
$149.00
In stock
SKU
60247-1-Ig
| Catalog Number | 60247-1-Ig |
| Synonyms | KRT15, 6B4F8, CK 15, CK15, CK-15 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | A431 cells |
| Tested Applications — Positive IHC detected in | human skin cancer tissue, human cervical cancer tissue, mouse skin tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, A431 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Positive WB detected in | A431 cells |
| Positive IHC detected in | human skin cancer tissue, human cervical cancer tissue, mouse skin tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, A431 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0185 Product name: Recombinant human KRT15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-450 aa of BC002641 Sequence: AYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS Predict reactive species |
| Full Name | keratin 15 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC002641 |
| Gene Symbol | KRT15 |
| Gene ID (NCBI) | 3866 |
| RRID | AB_2881369 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P19012 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Cytokeratin 15 antibody 60247-1-Ig | Download protocol |
| IHC protocol for Cytokeratin 15 antibody 60247-1-Ig | Download protocol |
| WB protocol for Cytokeratin 15 antibody 60247-1-Ig | Download protocol |
| mouse | IHC,IF J Ginseng Res Anti-skin aging effects of black ginseng extracts through regulating inflammatory factors and the CLOCK-ERK pathway in mice. Authors - Yufei Huang View Article |
| human | IHC Cell Biosci Multi-omics analysis unveiled fibroblast-mediated pathogenesis in male genital lichen sclerosus. Authors - Lede Lin View Article |
| Citations | 6 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:2000-1:8000 IF/ICC : 1:125-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 6B4F8 |
| Conjugation | Unconjugated |
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 15 is a type I cytokeratin. It is found in some progenitor basal cells within complex epithelia. Protocols Product Specific Protocols IF protocol for Cytokeratin 15 antibody 60247-1-Ig Download protocol IHC protocol for Cytokeratin 15 antibody 60247-1-Ig Download protocol WB protocol for Cytokeratin 15 antibody 60247-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Exosomes Derived from Dermal Papilla Cells Mediate Hair Follicle Stem Cell Proliferation through the Wnt3a/β-Catenin Signaling Pathway
Journal: Oxid Med Cell Longev | Authors: Jiali Li | Application: IF - Functional study of Krt17 in corneal epithelial regeneration and stemness regulation.
Journal: Exp Eye Res | Authors: Xueer Zheng | Species: mouse | Application: WB - Stimulation by exosomes from hypoxia-preconditioned hair follicle mesenchymal stem cells facilitates mitophagy by inhibiting the PI3K/AKT/mTOR signaling pathway to alleviate ulcerative colitis
Journal: Theranostics | Authors: Ning Li | Species: mouse | Application: IF - M2 macrophage-derived exosomes deliver NGF-modified mRNA to promote comprehensive corneal repair.
Journal: J Control Release | Authors: Danni Gong | Species: mouse | Application: IHC,IF - Anti-skin aging effects of black ginseng extracts through regulating inflammatory factors and the CLOCK-ERK pathway in mice.
Journal: J Ginseng Res | Authors: Yufei Huang | Species: mouse | Application: IHC,IF - Multi-omics analysis unveiled fibroblast-mediated pathogenesis in male genital lichen sclerosus.
Journal: Cell Biosci | Authors: Lede Lin | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
