Ezrin Polyclonal antibody 26056-1-AP proteintech
$149.00
In stock
SKU
26056-1-AP
| Catalog Number | 26056-1-AP |
| Synonyms | EZR, VIL2, Villin-2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA |
| Applications | WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse stomach tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat eye tissue, mouse eye tissue |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:20000-1:100000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse stomach tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat eye tissue, mouse eye tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species |
| Full Name | ezrin |
| Calculated Molecular Weight | 69 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC013903 |
| Gene Symbol | Ezrin |
| Gene ID (NCBI) | 7430 |
| ENSEMBL Gene ID | ENSG00000092820 |
| RRID | AB_2722561 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15311 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Ezrin antibody 26056-1-AP | Download protocol |
| IF protocol for Ezrin antibody 26056-1-AP | Download protocol |
| IHC protocol for Ezrin antibody 26056-1-AP | Download protocol |
| IP protocol for Ezrin antibody 26056-1-AP | Download protocol |
| WB protocol for Ezrin antibody 26056-1-AP | Download protocol |
| mouse,human | IF Acta Neuropathol Selective vulnerability of tripartite synapses in amyotrophic lateral sclerosis. Authors - Matthew J Broadhead View Article |
| human | WB Int J Mol Sci Bidirectional Tumor-Promoting Activities of Macrophage Ezrin. Authors - Krishnendu Khan KD Validated View Article |
| mouse | WB J Biol Chem Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. Authors - Songhua Li View Article |
| pig | WB,IF J Virol Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin Authors - Shujuan Zhang View Article |
| Citations | 24 |
| Dilutions | WB : 1:20000-1:100000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:50-1:500 IF/ICC : 1:400-1:1600 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis. Protocols Product Specific Protocols FC protocol for Ezrin antibody 26056-1-AP Download protocol IF protocol for Ezrin antibody 26056-1-AP Download protocol IHC protocol for Ezrin antibody 26056-1-AP Download protocol IP protocol for Ezrin antibody 26056-1-AP Download protocol WB protocol for Ezrin antibody 26056-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Selective vulnerability of tripartite synapses in amyotrophic lateral sclerosis.
Journal: Acta Neuropathol | Authors: Matthew J Broadhead | Species: mouse,human | Application: IF - Cotranslational interaction of human EBP50 and ezrin overcomes masked binding site during complex assembly.
Journal: Proc Natl Acad Sci U S A | Authors: Krishnendu Khan KO Validated | Species: human | Application: WB - Gq activity- and β-arrestin-1 scaffolding-mediated ADGRG2/CFTR coupling are required for male fertility.
Journal: Elife | Authors: Dao-Lai Zhang | Species: mouse | Application: WB - Bidirectional Tumor-Promoting Activities of Macrophage Ezrin.
Journal: Int J Mol Sci | Authors: Krishnendu Khan KD Validated | Species: human | Application: WB - Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments.
Journal: J Biol Chem | Authors: Songhua Li | Species: mouse | Application: WB - Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin
Journal: J Virol | Authors: Shujuan Zhang | Species: pig | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
