Ezrin Recombinant monoclonal antibody 85790-4-RR proteintech
$149.00
In stock
SKU
85790-4-RR
| Catalog Number | 85790-4-RR |
| Synonyms | EZR, VIL2, Villin-2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, Calu-3 cells, A431 cells, Jurkat cells, MOLT-4 cells, NIH/3T3 cells, C6 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse stomach tissue, Mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, Calu-3 cells, A431 cells, Jurkat cells, MOLT-4 cells, NIH/3T3 cells, C6 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse stomach tissue, Mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species |
| Full Name | ezrin |
| Calculated Molecular Weight | 69 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC013903 |
| Gene Symbol | Ezrin |
| Gene ID (NCBI) | 7430 |
| ENSEMBL Gene ID | ENSG00000092820 |
| RRID | AB_3744376 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P15311 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Ezrin antibody 85790-4-RR | Download protocol |
| IHC protocol for Ezrin antibody 85790-4-RR | Download protocol |
| IP protocol for Ezrin antibody 85790-4-RR | Download protocol |
| WB protocol for Ezrin antibody 85790-4-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:2000-1:8000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250065E1 |
| Conjugation | Unconjugated |
Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis. Protocols Product Specific Protocols IF protocol for Ezrin antibody 85790-4-RR Download protocol IHC protocol for Ezrin antibody 85790-4-RR Download protocol IP protocol for Ezrin antibody 85790-4-RR Download protocol WB protocol for Ezrin antibody 85790-4-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
