FABP6 Recombinant monoclonal antibody, PBS Only (Detector) 84132-2-PBS proteintech
$699.00
In stock
SKU
84132-2-PBS
| Catalog Number | 84132-2-PBS |
| Synonyms | Fatty acid binding protein 6, Fatty acid-binding protein 6, Gastrotropin, GT, I-15P |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag4788 Product name: Recombinant human FABP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC022489 Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Predict reactive species |
| Full Name | fatty acid binding protein 6, ileal |
| Calculated Molecular Weight | 177 aa, 20 kDa |
| GenBank Accession Number | BC022489 |
| Gene Symbol | FABP6 |
| Gene ID (NCBI) | 2172 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P51161 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241095A11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
