FADS2-Specific Recombinant monoclonal antibody, PBS Only 84527-2-PBS proteintech
$699.00
In stock
SKU
84527-2-PBS
| Catalog Number | 84527-2-PBS |
| Synonyms | FADS2, Acyl-CoA 6-desaturase, D6D, Delta-6 desaturase, EC:1.14.19.3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species |
| Full Name | fatty acid desaturase 2 |
| Calculated Molecular Weight | 445 aa, 49 kDa |
| GenBank Accession Number | BC009011 |
| Gene Symbol | FADS2 |
| Gene ID (NCBI) | 9415 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O95864 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241863G1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
