FAM71F1 Polyclonal antibody 27984-1-AP proteintech
$149.00
In stock
SKU
27984-1-AP
| Catalog Number | 27984-1-AP |
| Synonyms | FAM137A, FAM71F1, NYD SP18, Protein FAM137A, Protein FAM71F1 |
| Host | Rabbit |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Positive WB detected in | A549 cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Tested Reactivity | Human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16525 Product name: Recombinant human FAM71F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-342 aa of BC037248 Sequence: NCSSPSGDSKLVQKKLQASQPSESLIQLMTKGESEALSQIFADLHQQNQLRSSRKVETNKNSSGKDSSREDSIPCTCDLRWRASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAPPIGNSI Predict reactive species |
| Full Name | family with sequence similarity 71, member F1 |
| Calculated Molecular Weight | 342 aa, 39 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC037248 |
| Gene Symbol | FAM71F1 |
| Gene ID (NCBI) | 84691 |
| RRID | AB_2881030 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KD3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for FAM71F1 antibody 27984-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:8000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FAM71F1, also named GARIN1B and FAM137A, belongs to the GARIN family. FAM71F1 is a testis-enriched protein containing a RAB2B-binding domain, a small GTPase involved in vesicle transport and membrane trafficking (PMID: 34714330). Protocols Product Specific Protocols WB protocol for FAM71F1 antibody 27984-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
