FBP17 Recombinant monoclonal antibody, PBS Only 86852-2-PBS proteintech
$699.00
In stock
SKU
86852-2-PBS
| Catalog Number | 86852-2-PBS |
| Synonyms | FNBP1, Formin-binding protein 1, Formin-binding protein 17 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25784 Product name: Recombinant human FNBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-241 aa of BC101755 Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV Predict reactive species |
| Full Name | formin binding protein 1 |
| Observed Molecular Weight | 80-85 kDa |
| GenBank Accession Number | BC101755 |
| Gene Symbol | FBP17 |
| Gene ID (NCBI) | 23048 |
| RRID | AB_3745164 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96RU3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251876G12 |
| Conjugation | Unconjugated |
FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
