FBP2 Recombinant monoclonal antibody, PBS Only (Detector) 83910-3-PBS proteintech
$699.00
In stock
SKU
83910-3-PBS
| Catalog Number | 83910-3-PBS |
| Synonyms | D-fructose-1,6-bisphosphate 1-phosphohydrolase 2, EC:3.1.3.11, FBPase 2, Fructose-1,6-bisphosphatase isozyme 2, Muscle FBPase |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species |
| Full Name | fructose-1,6-bisphosphatase 2 |
| Calculated Molecular Weight | 339 aa, 37 kDa |
| GenBank Accession Number | BC113632 |
| Gene Symbol | FBP2 |
| Gene ID (NCBI) | 8789 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O00757 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240879F6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
