PGAM1 Monoclonal antibody 67470-1-Ig proteintech
$149.00
In stock
SKU
67470-1-Ig
| Catalog Number | 67470-1-Ig |
| Synonyms | 2H2A9, BPG-dependent PGAM 1, CDABP0006, EC:5.4.2.11, PGAM 1 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | U2OS cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, A549 cells, LNCaP cells, K-562 cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | U2OS cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, A549 cells, LNCaP cells, K-562 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9250 Product name: Recombinant human PGAM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-254 aa of BC011678 Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK Predict reactive species |
| Full Name | phosphoglycerate mutase 1 (brain) |
| Calculated Molecular Weight | 254 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC011678 |
| Gene Symbol | PGAM1 |
| Gene ID (NCBI) | 5223 |
| RRID | AB_2882699 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P18669 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PGAM1 antibody 67470-1-Ig | Download protocol |
| IHC protocol for PGAM1 antibody 67470-1-Ig | Download protocol |
| WB protocol for PGAM1 antibody 67470-1-Ig | Download protocol |
| human | IF Oncol Res Phosphoglycerate Mutase 1 (PGAM1) Promotes Pancreatic Ductal Adenocarcinoma (PDAC) Metastasis by Acting as a Novel Downstream Target of the PI3K/Akt/mTOR Pathway Authors - Xinlu Liu KD Validated View Article |
| mouse,human | WB,IHC J Nanobiotechnology Tumor microenvironment-activated cancer cell membrane-liposome hybrid nanoparticle-mediated synergistic metabolic therapy and chemotherapy for non-small cell lung cancer. Authors - Wei Zhang KD Validated View Article |
| Citations | 5 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:200-1:1000 IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2H2A9 |
| Conjugation | Unconjugated |
PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology. Protocols Product Specific Protocols IF protocol for PGAM1 antibody 67470-1-Ig Download protocol IHC protocol for PGAM1 antibody 67470-1-Ig Download protocol WB protocol for PGAM1 antibody 67470-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The glycolytic enzyme PGAM1 functions as a metabolic-autophagy checkpoint to coordinate growth and stress tolerance
Journal: Nat Cell Biol | Authors: Yi Zhang | Species: human | Application: WB - Tumor microenvironment-activated cancer cell membrane-liposome hybrid nanoparticle-mediated synergistic metabolic therapy and chemotherapy for non-small cell lung cancer.
Journal: J Nanobiotechnology | Authors: Wei Zhang KD Validated | Species: mouse,human | Application: WB,IHC - Hypoxia induces microtubule rearrangement in intestinal epithelial cells.
Journal: Am J Physiol Cell Physiol | Authors: Darragh Flood - Phosphoglycerate Mutase 1 (PGAM1) Promotes Pancreatic Ductal Adenocarcinoma (PDAC) Metastasis by Acting as a Novel Downstream Target of the PI3K/Akt/mTOR Pathway
Journal: Oncol Res | Authors: Xinlu Liu KD Validated | Species: human | Application: IF - Neonatal inflammation disrupts a temporally restricted postnatal Numb-enriched microglial state in mice.
Journal: Nat Commun | Authors: Jinjin Zhu
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
