FGF18 Polyclonal antibody 11495-1-AP proteintech
$149.00
In stock
SKU
11495-1-AP
| Catalog Number | 11495-1-AP |
| Synonyms | FGF 18, FGF-18, Fibroblast growth factor 18, UNQ420/PRO856, zFGF5 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse heart tissue, mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive IHC detected in | mouse heart tissue, mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2041 Product name: Recombinant human FGF18 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-207 aa of BC006245 Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA Predict reactive species |
| Full Name | fibroblast growth factor 18 |
| Calculated Molecular Weight | 207 aa, 24 kDa |
| GenBank Accession Number | BC006245 |
| Gene Symbol | FGF18 |
| Gene ID (NCBI) | 8817 |
| RRID | AB_2877770 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O76093 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for FGF18 antibody 11495-1-AP | Download protocol |
| IHC protocol for FGF18 antibody 11495-1-AP | Download protocol |
| mouse | WB,IF Ann Transl Med Cucurbitacin promotes hair growth in mice by inhibiting the expression of fibroblast growth factor 18 Authors - Keke Guo View Article |
| human | WB,IHC Adv Healthc Mater Targeted Therapy of Osteoarthritis via Intra-Articular Delivery of Lipid-Nanoparticle-Encapsulated Recombinant Human FGF18 mRNA Authors - Mengze Sun View Article |
| Citations | 9 |
| Dilutions | IHC : 1:200-1:800 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FGF18 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. Protocols Product Specific Protocols IF protocol for FGF18 antibody 11495-1-AP Download protocol IHC protocol for FGF18 antibody 11495-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Suppression of FGF5 and FGF18 Expression by Cholesterol-Modified siRNAs Promotes Hair Growth in Mice.
Journal: Front Pharmacol | Authors: Jungang Zhao | Species: mouse | Application: WB,IHC - HDAC7 promotes NSCLC proliferation and metastasis via stabilization by deubiquitinase USP10 and activation of β-catenin-FGF18 pathway.
Journal: J Exp Clin Cancer Res | Authors: Kai Guo | Species: human | Application: IHC - Cucurbitacin promotes hair growth in mice by inhibiting the expression of fibroblast growth factor 18
Journal: Ann Transl Med | Authors: Keke Guo | Species: mouse | Application: WB,IF - Targeted Therapy of Osteoarthritis via Intra-Articular Delivery of Lipid-Nanoparticle-Encapsulated Recombinant Human FGF18 mRNA
Journal: Adv Healthc Mater | Authors: Mengze Sun | Species: human | Application: WB,IHC - Remifentanil Mitigates Hepatic Ischemia/Reperfusion-Induced D1-Medium Spiny Neurons Damage via Fibroblast Growth Factor 18 Upregulation
Journal: Antioxid Redox Signal | Authors: Yujuan You | Application: IF - The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs.
Journal: Cell Mol Biol Lett | Authors: Yifen Shen | Application: WB - Fibroblast growth factor 18 stimulates chondrocyte proliferation by modulating FOXN2 to mitigate post-traumatic osteoarthritis in a mouse model.
Journal: Front Bioeng Biotechnol | Authors: Zhusong Huang | Species: human | Application: WB - Suppression of FGF5 and FGF18 Expression by Cholesterol-Modified siRNAs Promotes Hair Growth in Mice.
Journal: Front Pharmacol | Authors: Jungang Zhao | Species: mouse | Application: WB,IHC - Cucurbitacin promotes hair growth in mice by inhibiting the expression of fibroblast growth factor 18
Journal: Ann Transl Med | Authors: Keke Guo | Species: mouse | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
