FOXA1 Recombinant monoclonal antibody, PBS Only (Capture) 85125-4-PBS proteintech
$699.00
In stock
SKU
85125-4-PBS
| Catalog Number | 85125-4-PBS |
| Synonyms | HNF 3A, HNF 3 alpha, Hepatocyte nuclear factor 3-alpha, Forkhead box protein A1, forkhead box A1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag14243 Product name: Recombinant human FOXA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 267-399 aa of BC033890 Sequence: KCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP Predict reactive species |
| Full Name | forkhead box A1 |
| Calculated Molecular Weight | 473 aa, 49 kDa |
| GenBank Accession Number | BC033890 |
| Gene Symbol | FOXA1 |
| Gene ID (NCBI) | 3169 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P55317 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242658F4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
