FUNDC1 Polyclonal antibody 28519-1-AP proteintech
$149.00
In stock
SKU
28519-1-AP
| Catalog Number | 28519-1-AP |
| Synonyms | FUN14 domain containing 1, FUN14 domain-containing protein 1, FUNDC 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (3) |
| Reactivity | human, mouse, rat, monkey, chicken, goat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, CoIP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | RAW 264.7 cells, A-673 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue, C6 cells |
| Tested Applications — Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:20000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | RAW 264.7 cells, A-673 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue, C6 cells |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, goat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29358 Product name: Recombinant human FUNDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-155 aa of BC042813 Sequence: QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS Predict reactive species |
| Full Name | FUN14 domain containing 1 |
| Calculated Molecular Weight | 155 aa, 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC042813 |
| Gene Symbol | FUNDC1 |
| Gene ID (NCBI) | 139341 |
| RRID | AB_2935469 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IVP5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for FUNDC1 antibody 28519-1-AP | Download protocol |
| WB protocol for FUNDC1 antibody 28519-1-AP | Download protocol |
| mouse | WB Free Radic Biol Med Targeting the mTOR-mitochondrial function axis: Calcitriol attenuates sarcopenic obesity with lipid dysregulation etiology. Authors - Shangheng Fan View Article |
| rat | IHC Redox Biol Targeting Dio3 to enhance mitophagy and ameliorate skeletal muscle wasting in sepsis Authors - Gang Wang View Article |
| human | WB Eur J Pharmacol NF-κB/TOM6/PINK1-mediated mitophagy attenuates vascular calcification: Luteolin as a therapeutic modulator. Authors - Jinhe Li View Article |
| goat | WB FASEB J Zearalenone modulates the function of goat endometrial cells via the mitochondrial quality control system Authors - Guomin Zhang View Article |
| Citations | 30 |
| Dilutions | WB : 1:5000-1:20000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FUNDC1 is a novel mitochondrial-associated membrane (MAM) protein, enriched at the MAM by interacting with the ER resident protein CANX (calnexin) under hypoxia. As mitophagy proceeds, it dissociates from CANX and preferably recruits DNM1L/DRP1 to drive mitochondrial fission in response to hypoxic stress. Protocols Product Specific Protocols IHC protocol for FUNDC1 antibody 28519-1-AP Download protocol WB protocol for FUNDC1 antibody 28519-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Loss of FoxO1 activates an alternate mechanism of mitochondrial quality control for healthy adipose browning
Journal: Clin Sci (Lond) | Authors: Limin Shi KD Validated | Species: mouse | Application: WB - Oxidative stress-preconditioned exosomes target BMF to restore mitophagy for alleviating intervertebral disc degeneration.
Journal: Autophagy | Authors: Yun Teng - Targeting Dio3 to enhance mitophagy and ameliorate skeletal muscle wasting in sepsis
Journal: Redox Biol | Authors: Gang Wang | Species: rat | Application: IHC - NF-κB/TOM6/PINK1-mediated mitophagy attenuates vascular calcification: Luteolin as a therapeutic modulator.
Journal: Eur J Pharmacol | Authors: Jinhe Li | Species: human | Application: WB - Targeting the mTOR-mitochondrial function axis: Calcitriol attenuates sarcopenic obesity with lipid dysregulation etiology.
Journal: Free Radic Biol Med | Authors: Shangheng Fan | Species: mouse | Application: WB - Zearalenone modulates the function of goat endometrial cells via the mitochondrial quality control system
Journal: FASEB J | Authors: Guomin Zhang | Species: goat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
