FXYD6 Polyclonal antibody 15805-1-AP proteintech
$149.00
In stock
SKU
15805-1-AP
| Catalog Number | 15805-1-AP |
| Synonyms | FXYD domain-containing ion transport regulator 6, Phosphohippolin, UNQ521/PRO1056 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | PC-12 cells, COLO 320 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue, SH-SY5Y cells |
| Tested Applications — Positive IHC detected in | rat brain tissue, human brain tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | PC-12 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | PC-12 cells, COLO 320 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue, SH-SY5Y cells |
| Positive IHC detected in | rat brain tissue, human brain tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8538 Product name: Recombinant human FXYD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-95 aa of BC018652 Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 6 |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC018652 |
| Gene Symbol | FXYD6 |
| Gene ID (NCBI) | 53826 |
| RRID | AB_2108625 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0Q3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| IHC protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| WB protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| mouse | IF J Am Soc Nephrol Single-Cell RNA Sequencing Reveals Renal Endothelium Heterogeneity and Metabolic Adaptation to Water Deprivation. Authors - Sébastien J Dumas View Article |
| human | WB Front Immunol Identification of prognostic subtypes and the role of FXYD6 in ovarian cancer through multi-omics clustering Authors - Boyi Ma View Article |
| Citations | 4 |
| Dilutions | WB : 1:500-1:3000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia. Protocols Product Specific Protocols IF protocol for FXYD6 antibody 15805-1-AP Download protocol IHC protocol for FXYD6 antibody 15805-1-AP Download protocol WB protocol for FXYD6 antibody 15805-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Single-Cell RNA Sequencing Reveals Renal Endothelium Heterogeneity and Metabolic Adaptation to Water Deprivation.
Journal: J Am Soc Nephrol | Authors: Sébastien J Dumas | Species: mouse | Application: IF - Identification of FXYD6 as the novel biomarker for glioma based on differential expression and DNA methylation
Journal: Cancer Med | Authors: Weiliang Hou | Species: human | Application: WB,IF - FXYD6 Regulates Chemosensitivity by Mediating the Expression of Na+/K+-ATPase α1 and Affecting Cell Autophagy and Apoptosis in Colorectal Cancer.
Journal: Biomed Res Int | Authors: Wen Luo KD Validated | Species: human | Application: WB - Identification of prognostic subtypes and the role of FXYD6 in ovarian cancer through multi-omics clustering
Journal: Front Immunol | Authors: Boyi Ma | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
