Frizzled 10 Polyclonal antibody 18175-1-AP proteintech
$149.00
In stock
SKU
18175-1-AP
| Catalog Number | 18175-1-AP |
| Synonyms | FZD10, FzE7, Fz-10, FZ 10, Frizzled-10 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (3) |
| Reactivity | human, mouse, rat, chicken, zebrafish, goat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse kidney tissue, HeLa cells |
| Tested Applications — Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human kidney tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | mouse kidney tissue, HeLa cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken, zebrafish, goat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12867 Product name: Recombinant human FZD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-229 aa of BC074998 Sequence: SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV Predict reactive species |
| Full Name | frizzled homolog 10 (Drosophila) |
| Calculated Molecular Weight | 581 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC074998 |
| Gene Symbol | Frizzled 10 |
| Gene ID (NCBI) | 11211 |
| RRID | AB_2108942 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9ULW2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Frizzled 10 antibody 18175-1-AP | Download protocol |
| IHC protocol for Frizzled 10 antibody 18175-1-AP | Download protocol |
| WB protocol for Frizzled 10 antibody 18175-1-AP | Download protocol |
| mouse | WB,FC Nat Commun Progenitor translatome changes coordinated by Tsc1 increase perception of Wnt signals to end nephrogenesis. Authors - Alison E Jarmas View Article |
| chicken | IHC,IF Development Coupling of apical-basal polarity and PCP to interpret the Wnt signaling gradient and orient feather branch. Authors - Jianqiong Lin View Article |
| zebrafish | WB Development Wnt/β-catenin signaling directly regulates Foxj1 expression and ciliogenesis in zebrafish Kupffer's vesicle. Authors - Alissa Caron View Article |
| human | WB Int J Oncol Notch1 promotes hepatitis B virus X protein-induced hepatocarcinogenesis via Wnt/β-catenin pathway. Authors - Qian Sun View Article |
| goat | IHC Cells Integrative Analysis of Methylome and Transcriptome Reveals the Regulatory Mechanisms of Hair Follicle Morphogenesis in Cashmere Goat. Authors - Shanhe Wang View Article |
| Susanne (Verified Customer) (04-17-2023) | staining was not so nice like Frizzled 5, 7 or 9 from Proteintech Applications: Immunofluorescence Primary Antibody Dilution: 1:50 Cell Tissue Type: Fibroblasts Frizzled 10 Antibody Immunofluorescence validation (1:50 dilution) in Fibroblasts (Cat no:18175-1-AP) |
| Sylvain (Verified Customer) (12-11-2018) | Perfect signal! Applications: Immunohistochemistry, Primary Antibody Dilution: 1:100 Cell Tissue Type: human colon cancer |
| Citations | 9 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:20-1:200 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FZD10 (Frizzled homolog 10) is a member of the frizzled gene family, and considered as a seven-transmembrane Wnt-signaling receptor. FZD10 is expressed at high levels on the cell surface of almost all synovial sarcoma tissues but absent in most normal organs except for placenta. Up-regulation of FZD10 mRNA in several types of human cells might lead to carcinogenesis through activation of the beta-catenin-TCF signaling pathway with some class of WNTs. Protocols Product Specific Protocols IF protocol for Frizzled 10 antibody 18175-1-AP Download protocol IHC protocol for Frizzled 10 antibody 18175-1-AP Download protocol WB protocol for Frizzled 10 antibody 18175-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Progenitor translatome changes coordinated by Tsc1 increase perception of Wnt signals to end nephrogenesis.
Journal: Nat Commun | Authors: Alison E Jarmas | Species: mouse | Application: WB,FC - Coupling of apical-basal polarity and PCP to interpret the Wnt signaling gradient and orient feather branch.
Journal: Development | Authors: Jianqiong Lin | Species: chicken | Application: IHC,IF - Wnt/β-catenin signaling directly regulates Foxj1 expression and ciliogenesis in zebrafish Kupffer's vesicle.
Journal: Development | Authors: Alissa Caron | Species: zebrafish | Application: WB - Non coding RNA analysis in fibrolamellar hepatocellular carcinoma.
Journal: Oncotarget | Authors: Benjamin A Farber | Species: human | Application: WB - Notch1 promotes hepatitis B virus X protein-induced hepatocarcinogenesis via Wnt/β-catenin pathway.
Journal: Int J Oncol | Authors: Qian Sun | Species: human | Application: WB - Integrative Analysis of Methylome and Transcriptome Reveals the Regulatory Mechanisms of Hair Follicle Morphogenesis in Cashmere Goat.
Journal: Cells | Authors: Shanhe Wang | Species: goat | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
