Frizzled 2 Polyclonal antibody 24272-1-AP proteintech
$149.00
In stock
SKU
24272-1-AP
| Catalog Number | 24272-1-AP |
| Synonyms | FZD2, Frizzled-2, Fz 2, Fz-2, FzE2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Caco-2 cells, mouse colon tissue, rat kidney tissue, HEK-293 cells, mouse colon tisue |
| Tested Applications — Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | Caco-2 cells, mouse colon tissue, rat kidney tissue, HEK-293 cells, mouse colon tisue |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18003 Product name: Recombinant human FZD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-217 aa of BC113402 Sequence: CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG Predict reactive species |
| Full Name | frizzled homolog 2 (Drosophila) |
| Calculated Molecular Weight | 565 aa, 64 kDa |
| Observed Molecular Weight | 64-70 kDa |
| GenBank Accession Number | BC113402 |
| Gene Symbol | Frizzled 2 |
| Gene ID (NCBI) | 2535 |
| RRID | AB_2879463 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14332 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Frizzled 2 antibody 24272-1-AP | Download protocol |
| WB protocol for Frizzled 2 antibody 24272-1-AP | Download protocol |
| mouse | WB Evid Based Complement Alternat Med Intervention Mechanism of Hunag-Lian Jie-Du Decoction on Canonical Wnt/β-Catenin Signaling Pathway in Psoriasis Mouse Model. Authors - Xuesong Yang View Article |
| human | WB Cell Death Discov Cholesterol activates the Wnt/PCP-YAP signaling in SOAT1-targeted treatment of colon cancer. Authors - Huanji Xu KD Validated View Article |
| rat | WB Pharm Biol Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF. Authors - Ying Xu View Article |
| Citations | 17 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Frizzled 2(FZD2) also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. FZD2 is an important receptor in the Wnt pathway, which is highly expressed in malignant tumors and helps regulate multiple tumor behaviors. Its expression level is related to prognosis. Moreover, high level of FZD2 had significant correlation with poor prognosis in Breast cancer (BC) patients(PMID: 33832493). Protocols Product Specific Protocols IHC protocol for Frizzled 2 antibody 24272-1-AP Download protocol WB protocol for Frizzled 2 antibody 24272-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Electroacupuncture promotes neurogenesis in the dentate gyrus and improves pattern separation in an early Alzheimer's disease mouse model
Journal: Biol Res | Authors: Yanyi Ding | Species: mouse | Application: WB - Expression and (Lacking) Internalization of the Cell Surface Receptors of Clostridioides difficile Toxin B.
Journal: Front Microbiol | Authors: Dennis Schöttelndreier | Species: human | Application: WB - Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF.
Journal: Pharm Biol | Authors: Ying Xu | Species: rat | Application: WB - Intervention Mechanism of Hunag-Lian Jie-Du Decoction on Canonical Wnt/β-Catenin Signaling Pathway in Psoriasis Mouse Model.
Journal: Evid Based Complement Alternat Med | Authors: Xuesong Yang | Species: mouse | Application: WB - Depletion of VPS35 attenuates metastasis of hepatocellular carcinoma by restraining the Wnt/PCP signaling pathway.
Journal: Genes Dis | Authors: Yi Liu | Species: human | Application: WB - Cholesterol activates the Wnt/PCP-YAP signaling in SOAT1-targeted treatment of colon cancer.
Journal: Cell Death Discov | Authors: Huanji Xu KD Validated | Species: human | Application: WB - ZNF831-YTHDF1-DNMT1/3a feedback loop regulates lung carcinogenesis and progression through WNT7B-FZD5-β-catenin signalling axis
Journal: Free Radic Biol Med | Authors: Dongjiao Chen | Application: WB - M1-BMDMs with Wnt5a deletion attenuate liver fibrosis by suppression of Wnt5a/Frizzled 2 axis in hepatic progenitors
Journal: Cell Biosci | Authors: Fei-Fei Xing - Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF.
Journal: Pharm Biol | Authors: Ying Xu | Species: rat | Application: WB - Expression and (Lacking) Internalization of the Cell Surface Receptors of Clostridioides difficile Toxin B.
Journal: Front Microbiol | Authors: Dennis Schöttelndreier | Species: human | Application: WB - Electroacupuncture promotes neurogenesis in the dentate gyrus and improves pattern separation in an early Alzheimer's disease mouse model
Journal: Biol Res | Authors: Yanyi Ding | Species: mouse | Application: WB - MBD2 promotes epithelial-to-mesenchymal transition (EMT) and ARDS-related pulmonary fibrosis by modulating FZD2
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Yang Zhou | Species: mouse | Application: WB - Gen inhibiting the Wnt/Ca2+ signaling pathway alleviates cerebral ischemia/reperfusion injury
Journal: Sci Rep | Authors: Li Li | Species: rat | Application: WB,IF - The oncogenic role and regulatory mechanism of ACAA2 in human ovarian cancer
Journal: Mol Carcinog | Authors: Yahui Leng | Species: human | Application: WB - Exosomal miR-320e through wnt2targeted inhibition of the Wnt/β-catenin pathway allevisate cerebral small vessel disease and cognitive impairment
Journal: World J Psychiatry | Authors: Zheng Wang | Species: human | Application: WB - Interference of FZD2 suppresses proliferation, vasculogenic mimicry and stemness in glioma cells via blocking the Notch/NF‑κB signaling pathway
Journal: Exp Ther Med | Authors: Yuge Ran | Species: human | Application: WB - Intervention Mechanism of Hunag-Lian Jie-Du Decoction on Canonical Wnt/β-Catenin Signaling Pathway in Psoriasis Mouse Model.
Journal: Evid Based Complement Alternat Med | Authors: Xuesong Yang | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
