Mouse Foxp3 Recombinant monoclonal antibody, PBS Only 85128-3-PBS proteintech
$699.00
In stock
SKU
85128-3-PBS
| Catalog Number | 85128-3-PBS |
| Synonyms | forkhead box P3, Forkhead box protein P3 41 kDa form, Forkhead box protein P3, C-terminally processed, JM2, scurfin |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | IHC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg4360 Product name: Recombinant Mouse Foxp3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 10007378 of Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS Predict reactive species |
| Full Name | forkhead box P3 |
| Gene Symbol | Foxp3 |
| Gene ID (NCBI) | 20371 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99JB6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242674G9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
