CoraLite® Plus 488-conjugated GABARAPL1 Polyclonal antibody CL488-11010 proteintech
$479.00
In stock
SKU
CL488-11010
| Catalog Number | CL488-11010 |
| Synonyms | GABA(A) receptor-associated protein-like 1, Early estrogen-regulated protein, ATG8L, ATG8, APG8L |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | Chloroquine treated HepG2 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | Chloroquine treated HepG2 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species |
| Full Name | GABA(A) receptor-associated protein like 1 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC009309 |
| Gene Symbol | GABARAPL1 |
| Gene ID (NCBI) | 23710 |
| RRID | AB_2934401 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Antigen Affinity Purified |
| UNIPROT ID | Q9H0R8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 GABARAPL1 antibody CL488-11010 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | CoraLite® Plus 488 |
GABARAPL1 (GABARAP-like protein 1), also named as ATG8, GEC1, APG8L, ATG8L and APG8-LIKE, is a member of GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2, and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle and at very low levels in thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2. Protocols Product Specific Protocols IF protocol for CL Plus 488 GABARAPL1 antibody CL488-11010 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
