BIK Monoclonal antibody 68438-1-Ig proteintech
$149.00
In stock
SKU
68438-1-Ig
| Catalog Number | 68438-1-Ig |
| Synonyms | Apoptosis inducer NBK, BIK, BIP1, BP4, NBK |
| Host | Mouse |
| Reactivity | Human and More (2) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | SW480 cells, Caco-2 cells, THP-1 cells, Raji cells, Daudi cells, Ramos cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Positive WB detected in | SW480 cells, Caco-2 cells, THP-1 cells, Raji cells, Daudi cells, Ramos cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6353 Product name: Recombinant human BIK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-134 aa of BC001599 Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCE Predict reactive species |
| Full Name | BCL2-interacting killer (apoptosis-inducing) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC001599 |
| Gene Symbol | BIK |
| Gene ID (NCBI) | 638 |
| RRID | AB_3085151 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13323 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for BIK antibody 68438-1-Ig | Download protocol |
| human | WB Acta Pharm Sin B Avenanthramide A potentiates Bim-mediated antineoplastic properties of 5-fluorouracil via targeting KDM4C/MIR17HG/GSK-3β negative feedback loop in colorectal cancer Authors - Rong Fu View Article |
| mouse | WB Food Sci Nutr Radioprotective Efficacy of Jujube Aqueous Extract and Arbutin: Synergistic Antioxidant and Anti-Apoptotic Mechanisms in Radiation Injury. Authors - Liping Wang View Article |
| Citations | 2 |
| Dilutions | WB : 1:2000-1:10000 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 1B1C10 |
| Conjugation | Unconjugated |
The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. Protocols Product Specific Protocols WB protocol for BIK antibody 68438-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Avenanthramide A potentiates Bim-mediated antineoplastic properties of 5-fluorouracil via targeting KDM4C/MIR17HG/GSK-3β negative feedback loop in colorectal cancer
Journal: Acta Pharm Sin B | Authors: Rong Fu | Species: human | Application: WB - Radioprotective Efficacy of Jujube Aqueous Extract and Arbutin: Synergistic Antioxidant and Anti-Apoptotic Mechanisms in Radiation Injury.
Journal: Food Sci Nutr | Authors: Liping Wang | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
