GBE1 Polyclonal antibody 20313-1-AP proteintech
$149.00
In stock
SKU
20313-1-AP
| Catalog Number | 20313-1-AP |
| Synonyms | GSD4, Glycogen-branching enzyme, GBE, EC:2.4.1.18, APBD |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | L02 cells, human skeletal muscle tissue, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IP detected in | L02 cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | L02 cells, human skeletal muscle tissue, mouse liver tissue, rat liver tissue |
| Positive IP detected in | L02 cells |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14154 Product name: Recombinant human GBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC012098 Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM Predict reactive species |
| Full Name | glucan (1,4-alpha-), branching enzyme 1 |
| Calculated Molecular Weight | 702 aa, 80 kDa |
| Observed Molecular Weight | 72 kDa |
| GenBank Accession Number | BC012098 |
| Gene Symbol | GBE1 |
| Gene ID (NCBI) | 2632 |
| RRID | AB_10697658 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04446 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for GBE1 antibody 20313-1-AP | Download protocol |
| IP protocol for GBE1 antibody 20313-1-AP | Download protocol |
| WB protocol for GBE1 antibody 20313-1-AP | Download protocol |
| human | WB iScience MYCT1 alters the glycogen shunt by regulating selective translation of RACK1-mediated enzymes. Authors - Dong-Xue Ding View Article |
| rat | WB Carbohydr Polym Liver fibrosis alters the molecular structures of hepatic glycogen Authors - Yujun Wan View Article |
| mouse | WB J Proteome Res Global Phosphoproteomic Analysis Reveals Significant Metabolic Reprogramming in the Termination of Liver Regeneration in Mice. Authors - Jingzi Zhang View Article |
| Sarah (Verified Customer) (08-27-2025) | Antibody works well in preliminary experiments. I have not used this antibody extensively. Applications: Western Blot Cell Tissue Type: RPMI8226 |
| Sarah (Verified Customer) (08-07-2025) | Antibody works well with 1:1000 dilution and HRP secondary antibody. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: RPMI8226 |
| Citations | 14 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa. Protocols Product Specific Protocols IF protocol for GBE1 antibody 20313-1-AP Download protocol IP protocol for GBE1 antibody 20313-1-AP Download protocol WB protocol for GBE1 antibody 20313-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Splice-modulating antisense oligonucleotides targeting a pathogenic intronic variant in adult polyglucosan body disease correct mis-splicing and restore enzyme activity in patient cells
Journal: Nucleic Acids Res | Authors: Ria Thomas | Species: human | Application: WB - Loss of C2orf69 defines a fatal autoinflammatory syndrome in humans and zebrafish that evokes a glycogen storage-associated mitochondriopathy.
Journal: Am J Hum Genet | Authors: Hui Hui Wong KD Validated | Species: human | Application: WB - PYGL-mediated glucose metabolism reprogramming promotes EMT phenotype and metastasis of pancreatic cancer
Journal: Int J Biol Sci | Authors: Qian Ji | Species: human | Application: WB - Liver fibrosis alters the molecular structures of hepatic glycogen
Journal: Carbohydr Polym | Authors: Yujun Wan | Species: rat | Application: WB - MYCT1 alters the glycogen shunt by regulating selective translation of RACK1-mediated enzymes.
Journal: iScience | Authors: Dong-Xue Ding | Species: human | Application: WB - Global Phosphoproteomic Analysis Reveals Significant Metabolic Reprogramming in the Termination of Liver Regeneration in Mice.
Journal: J Proteome Res | Authors: Jingzi Zhang | Species: mouse | Application: WB - SIRT7 drives energy metabolic shifts in endometriosis via interaction with TUFM and Rhoa/Rock/Akt pathway activation.
Journal: Cell Mol Life Sci | Authors: Huaying Zhang | Species: human | Application: WB - Hypoxia-induced histone lactylation promotes pulmonary arterial smooth muscle cells proliferation in pulmonary hypertension.
Journal: Mol Cell Biochem | Authors: Ai Chen | Species: rat | Application: WB,IF - MYCT1 alters the glycogen shunt by regulating selective translation of RACK1-mediated enzymes.
Journal: iScience | Authors: Dong-Xue Ding | Species: human | Application: WB - Global Phosphoproteomic Analysis Reveals Significant Metabolic Reprogramming in the Termination of Liver Regeneration in Mice.
Journal: J Proteome Res | Authors: Jingzi Zhang | Species: mouse | Application: WB - Hallmarks of oxidative stress in the livers of aged mice with mild glycogen branching enzyme deficiency.
Journal: Arch Biochem Biophys | Authors: Dominika Malinska | Species: mouse | Application: WB - GBE1 alleviates MPTP-induced PD symptoms in mice by enhancing glycolysis and oxidative phosphorylation
Journal: Brain Res | Authors: Hongyan Chen | Species: mouse,rat | Application: WB,IF - A novel genetic model provides a unique perspective on the relationship between postexercise glycogen concentration and increases in the abundance of key metabolic proteins after acute exercise
Journal: PLoS One | Authors: Seong Eun Kwak | Species: rat | Application: WB - Induced pluripotent stem cell (iPSC) modeling validates reduced GBE1 enzyme activity due to a novel variant, p.Ile694Asn, found in a patient with suspected glycogen storage disease IV
Journal: Mol Genet Metab Rep | Authors: Chie Naito | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
