GCGR Polyclonal antibody 26784-1-AP proteintech
$149.00
In stock
SKU
26784-1-AP
| Catalog Number | 26784-1-AP |
| Synonyms | glucagon receptor, GL-R, GL R, GGR |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, mouse heart tissue |
| Tested Applications — Positive IHC detected in | human liver tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse liver tissue, mouse heart tissue |
| Positive IHC detected in | human liver tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24861 Product name: Recombinant human GCGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-141 aa of BC104854 Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF Predict reactive species |
| Full Name | glucagon receptor |
| Calculated Molecular Weight | 477 aa, 54 kDa |
| Observed Molecular Weight | 62-68 kDa |
| GenBank Accession Number | BC104854 |
| Gene Symbol | GCGR |
| Gene ID (NCBI) | 2642 |
| RRID | AB_2880634 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P47871 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for GCGR antibody 26784-1-AP | Download protocol |
| WB protocol for GCGR antibody 26784-1-AP | Download protocol |
| mouse | WB bioRxiv A Dual-Compartment Scaffolding Role for RACK1 in Hepatic Glucagon Signaling and Gluconeogenesis Authors - Cancan Lyu View Article |
| Citations | 11 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM). Protocols Product Specific Protocols IHC protocol for GCGR antibody 26784-1-AP Download protocol WB protocol for GCGR antibody 26784-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Pro-α-cell-derived β-cells contribute to β-cell neogenesis induced by antagonistic glucagon receptor antibody in type 2 diabetic mice.
Journal: iScience | Authors: Xiaona Cui | Species: mouse | Application: WB,IF - Irisin Alleviates Impaired Mitochondrial Fusion via Enhancing PKA/SIRT3/mTOR Pathway in Hepatic Steatosis
Journal: J Gastroenterol Hepatol | Authors: Jia Li - Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells.
Journal: Mol Cell Endocrinol | Authors: Xinghong Guo | Species: mouse | Application: WB - Tributyltin exposure disturbs hepatic glucose metabolism in male mice.
Journal: Toxicology | Authors: Jing Xu | Species: mouse | Application: WB - Glucagon receptor blockage inhibits β-cell dedifferentiation through FoxO1
Journal: Am J Physiol Endocrinol Metab | Authors: Kangli Wang | Species: mouse | Application: WB,IF - A Dual-Compartment Scaffolding Role for RACK1 in Hepatic Glucagon Signaling and Gluconeogenesis
Journal: bioRxiv | Authors: Cancan Lyu | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
