• Sign In
  • Create an Account
Toggle Nav
My Cart
Search
Advanced Search
  • Compare Products
Menu
Account

FUS/TLS Polyclonal antibody 11570-1-AP proteintech

Be the first to review this product
$149.00
In stock
SKU
11570-1-AP
Add to Wish List Add to Compare
Catalog No.SizePrice (USD)
11570-1-AP-20UL20 μL$149.00
11570-1-AP-150UL150 μL$449.00
main product photo
Catalog Number11570-1-AP
SynonymsFUS, 75 kDa DNA pairing protein, 75 kDa DNA-pairing protein, ALS, ALS6
HostRabbit
Reactivityhuman, mouse, rat and More (2)
Reactivityhuman, mouse, rat, chicken, yeast
FormLiquid
FormulationPBS, Azide, Glycerol
ApplicationsWB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, chIP, RIP, ELISA
ApplicationsWB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA
Host / IsotypeRabbit / IgG
Tested Applications — Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
Tested Applications — Positive IP detected inK-562 cells
Tested Applications — Positive IHC detected inrat brain tissue, human breast cancer tissue, human ovary tumor tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Tested Applications — Positive IF-P detected inmouse colon tissue, mouse liver tissue
Tested Applications — Positive IF-Fro detected inrat brain tissue
Tested Applications — Positive IF/ICC detected inHepG2 cells, HeLa cells
Recommended Dilutions — Western Blot (WB)WB : 1:5000-1:50000
Recommended Dilutions — Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Recommended Dilutions — Immunohistochemistry (IHC)IHC : 1:500-1:2000
Recommended Dilutions — Immunofluorescence (IF)-PIF-P : 1:50-1:500
Recommended Dilutions — Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Recommended Dilutions — Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IP detected inK-562 cells
Positive IHC detected inrat brain tissue, human breast cancer tissue, human ovary tumor tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, mouse liver tissue
Positive IF-Fro detected inrat brain tissue
Positive IF/ICC detected inHepG2 cells, HeLa cells
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Tested Reactivityhuman, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken, yeast
ClassPolyclonal
TypeAntibody
ImmunogenCatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species
Full Namefusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight75 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC026062
Gene SymbolFUS/TLS
Gene ID (NCBI)2521
RRIDAB_2247082
ConjugateUnconjugated
Purification MethodAntigen affinity purification
UNIPROT IDP35637
Storage BufferPBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
IF protocol for FUS/TLS antibody 11570-1-APDownload protocol
IHC protocol for FUS/TLS antibody 11570-1-APDownload protocol
IP protocol for FUS/TLS antibody 11570-1-APDownload protocol
WB protocol for FUS/TLS antibody 11570-1-APDownload protocol
mouseIHC Nature Divergent transcriptional regulation of astrocyte reactivity across disorders. Authors - Joshua E Burda View Article
humanWB Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. Authors - Mi Kyung Park View Article
mouse,humanWB Nat Med Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis. Authors - Vladislav A Korobeynikov View Article
Manon (Verified Customer) (01-26-2026)Good staining into the nucleus of FUS on fibroblast Applications: Immunofluorescence Primary Antibody Dilution: 1/100 Cell Tissue Type: Fibroblasts
Sonam (Verified Customer) (10-16-2025)Good Ab Applications: Western Blot Cell Tissue Type: Macrophages
Xiaochen (Verified Customer) (07-08-2024)Sensitivie for IF and show image with good quelity. Applications: Immunofluorescence Cell Tissue Type: U2OS FUS/TLS Antibody Immunofluorescence validation ( dilution) in U2OS (Cat no:11570-1-AP)
Xhuljana (Verified Customer) (03-01-2024)Used in siRNA transfected C2C12 cells Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: C2C12 cells FUS/TLS Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:11570-1-AP)
Zhongwen (Verified Customer) (09-25-2023)I can find two bands in the target region. I am not sure which one is the target band. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293T FUS/TLS Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:11570-1-AP)
manohar (Verified Customer) (07-10-2023)Nitrocellulose membrane is used with 5% milk as blocking and antibody diluted in 1% milk and incubated overnight. Applications: Western Blot, Immunofluorescence, Immunoprecipitation Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293, Neuronal stem cells, Mouse tissue
Tatyana (Verified Customer) (05-14-2023)ICC using 5% goat serum/PBST buffer, 2 hours at RT. Good specific nuclear signal. Applications: Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: HeLa FUS/TLS Antibody Immunofluorescence validation (1:1000 dilution) in HeLa (Cat no:11570-1-AP)
shashirekha (Verified Customer) (12-23-2020)Used for immunopreciptation at 1:1000 dilution. Works very well Applications: Immunoprecipitation Primary Antibody Dilution: 1:1000 Cell Tissue Type: Rat cortical neurons FUS/TLS Antibody Immunoprecipitation validation (1:1000 dilution) in Rat cortical neurons (Cat no:11570-1-AP)
H (Verified Customer) (04-06-2020)The antibody worked well for HCT116 cell line. Nuclear cytosolic fractionation clearly showed that FUS is dominantly in nucleus, and sub-fraction is present in cytosol. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: HCT116 FUS/TLS Antibody Western Blot validation (1:2000 dilution) in HCT116 (Cat no:11570-1-AP)
Karthik (Verified Customer) (04-24-2019)Magenta- FUSBlue- MAP2FUS staining consistent obtained with this antibody is consistent with literature Applications: Immunofluorescence, Primary Antibody Dilution: 1:250 overnight at 4 degrees Cell Tissue Type: motor neurons
Yen-Chen (Verified Customer) (12-03-2018)Applications: Western Blot, Immunofluorescence, Primary Antibody Dilution: 1:500 Cell Tissue Type: human motor neuron
Citations153
DilutionsWB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:50-1:500 IF-FRO : 1:50-1:500 IF/ICC : 1:50-1:500
IsotypeIgG
ClonalityPolyclonal
Clone Number-
ConjugationUnconjugated

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U) (PMID: 22640227). This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS aggregates are composed of different isoforms or fragments of various sizes, rather than only the main isoform. Bands of smaller or larger sizes (35 kDa, 75 kDa, and the gel top bands) were detected in P2h, and bands around 135 kDa and 245 kDa in S2h could be FUS oligomers (PMID: 35289333). Protocols Product Specific Protocols IF protocol for FUS/TLS antibody 11570-1-AP Download protocol IHC protocol for FUS/TLS antibody 11570-1-AP Download protocol IP protocol for FUS/TLS antibody 11570-1-AP Download protocol WB protocol for FUS/TLS antibody 11570-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols

Publications

  1. Antisense oligonucleotide jacifusen for FUS-ALS: an investigator-initiated, multicentre, open-label case series
    Journal: Lancet | Authors: Neil A Shneider | Application: WB
  2. Divergent transcriptional regulation of astrocyte reactivity across disorders.
    Journal: Nature | Authors: Joshua E Burda | Species: mouse | Application: IHC
  3. Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia.
    Journal: Nature | Authors: Deng Han-Xiang HX | Species: human | Application: IHC,IF
  4. Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis.
    Journal: Nat Med | Authors: Vladislav A Korobeynikov | Species: mouse,human | Application: WB
  5. Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains.
    Journal: Cell | Authors: Lin Guo | Species: human | Application: WB,IF
  6. NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.
    Journal: Cell Metab | Authors: Mi Kyung Park | Species: human | Application: WB
  7. CircLONP2 enhances colorectal carcinoma invasion and metastasis through modulating the maturation and exosomal dissemination of microRNA-17.
    Journal: Mol Cancer | Authors: Kai Han | Species: rat | Application: RIP
  8. NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.
    Journal: Cell Metab | Authors: Mi Kyung Park | Species: human | Application: WB
  9. A repeat expansion in GOLGA8A is a major risk factor for atypical frontotemporal lobar degeneration with ubiquitin-positive inclusions.
    Journal: Nat Genet | Authors: Wouter De Coster | Species: human | Application: IHC
  10. Paraspeckle condensation is controlled via TDP-43 polymerization and linked to neuroprotection.
    Journal: Nat Cell Biol | Authors: Rachel E Hodgson | Species: human | Application: WB,IF
  11. Interactions between ALS-linked FUS and nucleoporins are associated with defects in the nucleocytoplasmic transport pathway.
    Journal: Nat Neurosci | Authors: Yen-Chen Lin | Species: human | Application: IF
  12. FUS-mediated regulation of acetylcholine receptor transcription at neuromuscular junctions is compromised in amyotrophic lateral sclerosis.
    Journal: Nat Neurosci | Authors: Gina Picchiarelli | Species: mouse | Application: WB
  13. Directly converted patient-specific induced neurons mirror the neuropathology of FUS with disrupted nuclear localization in amyotrophic lateral sclerosis.
    Journal: Mol Neurodegener | Authors: Su Min Lim | Species: human | Application: IHC,IF
  14. Protective paraspeckle hyper-assembly downstream of TDP-43 loss of function in amyotrophic lateral sclerosis.
    Journal: Mol Neurodegener | Authors: Tatyana A Shelkovnikova | Species: human | Application: IF
  15. Wild-type FUS corrects ALS-like disease induced by cytoplasmic mutant FUS through autoregulation
    Journal: Mol Neurodegener | Authors: Inmaculada Sanjuan-Ruiz | Species: mouse | Application: IHC,IF
  16. Muscleblind acts as a modifier of FUS toxicity by modulating stress granule dynamics and SMN localization.
    Journal: Nat Commun | Authors: Ian Casci | Species: human | Application: WB
  17. FET proteins and PARylation-dependent condensates promote replication fork reversal and genome stability.
    Journal: Nat Commun | Authors: Celeste Giansanti
  18. Cytoplasmic FUS triggers early behavioral alterations linked to cortical neuronal hyperactivity and inhibitory synaptic defects.
    Journal: Nat Commun | Authors: Jelena Scekic-Zahirovic | Species: mouse | Application: WB,IF
  19. Mutant FUS causes DNA ligation defects to inhibit oxidative damage repair in Amyotrophic Lateral Sclerosis.
    Journal: Nat Commun | Authors: Haibo Wang | Species: human | Application: IF
  20. FET proteins and PARylation-dependent condensates promote replication fork reversal and genome stability.
    Journal: Nat Commun | Authors: Celeste Giansanti
  21. Distinct and shared functions of ALS-associated proteins TDP-43, FUS and TAF15 revealed by multisystem analyses.
    Journal: Nat Commun | Authors: Katannya Kapeli | Species: human | Application: WB
  22. TAF15 amyloids propagate via defined motifs in a prion-like fashion.
    Journal: Nat Commun | Authors: Katerina Konstantoulea
  23. Enhanced hybridization-proximity labeling discovers protein interactomes of single RNA molecules.
    Journal: Nat Commun | Authors: Karen Yap | Species: human | Application: IF
  24. PRMT5 is an actionable therapeutic target in CDK4/6 inhibitor-resistant ER+/RB-deficient breast cancer
    Journal: Nat Commun | Authors: Chang-Ching Lin | Species: human | Application: WB
  25. Identification of functional tetramolecular RNA G-quadruplexes derived from transfer RNAs.
    Journal: Nat Commun | Authors: Shawn M Lyons | Species: human | Application: WB
  26. Enhanced hybridization-proximity labeling discovers protein interactomes of single RNA molecules.
    Journal: Nat Commun | Authors: Karen Yap | Species: human | Application: IF
  27. PRMT5 is an actionable therapeutic target in CDK4/6 inhibitor-resistant ER+/RB-deficient breast cancer
    Journal: Nat Commun | Authors: Chang-Ching Lin | Species: human | Application: WB
  28. DNA nanoflower Oligo-PROTAC for targeted degradation of FUS to treat neurodegenerative diseases
    Journal: Nat Commun | Authors: Ruixin Ge | Species: rat,human | Application: WB,IP
  29. ALS/FTD-Linked Mutation in FUS Suppresses Intra-axonal Protein Synthesis and Drives Disease Without Nuclear Loss-of-Function of FUS.
    Journal: Neuron | Authors: Jone López-Erauskin | Species: mouse | Application: IF
  30. Nucleocytoplasmic mRNA redistribution accompanies RNA binding protein mislocalization in ALS motor neurons and is restored by VCP ATPase inhibition
    Journal: Neuron | Authors: Oliver J Ziff | Species: human | Application: IF
  31. Nucleocytoplasmic mRNA redistribution accompanies RNA binding protein mislocalization in ALS motor neurons and is restored by VCP ATPase inhibition
    Journal: Neuron | Authors: Oliver J Ziff | Species: human | Application: IF
  32. Defining RNA oligonucleotides that reverse deleterious phase transitions of RNA-binding proteins with prion-like domains.
    Journal: Mol Cell | Authors: Lin Guo | Species: human | Application: WB,IF
  33. A toolkit for the identification of NEAT1_2/paraspeckle modulators
    Journal: Nucleic Acids Res | Authors: Haiyan An | Species: human | Application: WB
  34. PARP-1 dependent recruitment of the amyotrophic lateral sclerosis-associated protein FUS/TLS to sites of oxidative DNA damage.
    Journal: Nucleic Acids Res | Authors: Rulten Stuart L SL | Species: human | Application: WB,IF
  35. Splicing factor FUS facilitates the progression of PIT1-lineage PitNETs by upregulating MDM2.
    Journal: Theranostics | Authors: Xu Wang | Species: rat,human | Application: WB,RIP,IHC,IF
  36. FUS/circ_002136/miR-138-5p/SOX13 feedback loop regulates angiogenesis in Glioma.
    Journal: J Exp Clin Cancer Res | Authors: Zhenwei He | Species: human | Application: WB
  37. CircHIPK2 Contributes Cell Growth in Intestinal Epithelial of Colitis and Colorectal Cancer through Promoting TAZ Translation
    Journal: Adv Sci (Weinh) | Authors: Xixi Zeng | Species: human | Application: WB,RIP
  38. M6A-dependent RNA condensation underlies FUS autoregulation and can be harnessed for ALS therapy development
    Journal: Sci Adv | Authors: Wan-Ping Huang
  39. Circular RNA circHomer1 mediates hippocampal functions via ribonucleoprotein granule transport and dendritic targeting of synaptic RNAs.
    Journal: Sci Adv | Authors: Ying Cai | Species: rat,mouse | Application: WB,RIP,IF
  40. PRKAR1B mutation associated with a new neurodegenerative disorder with unique pathology.
    Journal: Brain | Authors: Tsz Hang Wong | Species: human | Application: IHC
  41. Distinct clinical and pathological characteristics of frontotemporal dementia associated with C9ORF72 mutations.
    Journal: Brain | Authors: Snowden Julie S JS | Species: human | Application: IHC
  42. Asymmetry of post-mortem neuropathology in behavioural-variant frontotemporal dementia.
    Journal: Brain | Authors: David J Irwin | Species: human | Application: IHC
  43. Chronically stressed or stress-preconditioned neurons fail to maintain stress granule assembly.
    Journal: Cell Death Dis | Authors: Tatyana A Shelkovnikova | Species: mouse | Application: IF
  44. Regulation of Podocyte Injury by CircHIPK3/FUS Complex in Diabetic Kidney Disease
    Journal: Int J Biol Sci | Authors: Feng Liu | Species: mouse,human | Application: WB,RIP,ChIP
  45. Circular RNA circPLXNC1 functions as an inhibitor of senescence by regulating autophagy in osteoarthritis.
    Journal: Int J Biol Sci | Authors: Hongyi Zhou | Species: human | Application: WB,RIP
  46. Analysis of ALS-related proteins during herpes simplex virus-2 latent infection.
    Journal: J Neuroinflammation | Authors: Jorge Rubén Cabrera | Species: mouse | Application: WB,IF
  47. Localization of fused in sarcoma (FUS) protein to the post-synaptic density in the brain.
    Journal: Acta Neuropathol | Authors: Aoki Naoya N | Species: mouse,human | Application: WB,IHC
  48. Modeling key pathological features of frontotemporal dementia with C9ORF72 repeat expansion in iPSC-derived human neurons.
    Journal: Acta Neuropathol | Authors: Almeida Sandra S | Species: human | Application: IF
  49. FUS pathology in basophilic inclusion body disease.
    Journal: Acta Neuropathol | Authors: Munoz David G DG | Species: human | Application: IHC
  50. Optineurin is colocalized with ubiquitin in Marinesco bodies.
    Journal: Acta Neuropathol | Authors: Claudia Schwab | Species: human | Application: IHC
  51. Localization of fused in sarcoma (FUS) protein to the post-synaptic density in the brain.
    Journal: Acta Neuropathol | Authors: Aoki Naoya N | Species: mouse,human | Application: WB,IHC
  52. TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.
    Journal: Nat Struct Mol Biol | Authors: Xinxin Zuo | Species: mouse | Application: WB
  53. Altered distributions of Gemini of coiled bodies and mitochondria in motor neurons of TDP-43 transgenic mice.
    Journal: Proc Natl Acad Sci U S A | Authors: Shan Xiu X | Species: mouse | Application: IF
  54. The lncRNA ST18-AS1 suppresses pancreatic cancer progression by enhancing ST18 mRNA stability through anchoring FUS in the cytoplasm
    Journal: Oncogene | Authors: Long Cheng | Species: human | Application: WB
  55. Partial deletion of AFG3L2 causing spinocerebellar ataxia type 28.
    Journal: Neurology | Authors: Katrien Smets | Species: human | Application: IHC
  56. Phenotypic characteristics of Alzheimer patients carrying an ABCA7 mutation.
    Journal: Neurology | Authors: Tobi Van den Bossche
  57. Enhancing diabetic foot ulcer healing: Impact of the regulation of the FUS and ILF2 RNA‑binding proteins through negative pressure wound therapy
    Journal: Int J Mol Med | Authors: Ying Tang | Species: human | Application: WB,IHC
  58. Resolving the spatial and cellular architecture of intra-tumor heterogeneity by multi-region dissection of lung adenocarcinoma
    Journal: J Genet Genomics | Authors: Song Mei | Application: IF
  59. Antiviral Immune Response as a Trigger of FUS Proteinopathy in Amyotrophic Lateral Sclerosis.
    Journal: Cell Rep | Authors: Tatyana A Shelkovnikova | Species: human | Application: WB,IF
  60. hnRNPA2B1 represses the disassembly of arsenite-induced stress granules and is essential for male fertility
    Journal: Cell Rep | Authors: Xiaoli Wang | Species: human | Application: IF
  61. FUS-immunoreactive inclusions are a common feature in sporadic and non-SOD1 familial amyotrophic lateral sclerosis.
    Journal: Ann Neurol | Authors: Deng Han-Xiang HX | Species: human | Application: WB,IHC
  62. BraInMap Elucidates the Macromolecular Connectivity Landscape of Mammalian Brain.
    Journal: Cell Syst | Authors: Reza Pourhaghighi | Species: mouse | Application: WB
  63. Reversal of cognitive deficits in FUSR521G amyotrophic lateral sclerosis mice by arimoclomol and a class I histone deacetylase inhibitor independent of heat shock protein induction
    Journal: Neurotherapeutics | Authors: Mari Carmen Pelaez | Species: mouse | Application: WB
  64. Restoration of histone acetylation ameliorates disease and metabolic abnormalities in a FUS mouse model.
    Journal: Acta Neuropathol Commun | Authors: Elisabeth Rossaert | Species: mouse | Application: IF
  65. Diffuse argyrophilic grain disease with TDP-43 proteinopathy and neuronal intermediate filament inclusion disease: FTLD with mixed tau, TDP-43 and FUS pathologies
    Journal: Acta Neuropathol Commun | Authors: Shunsuke Koga | Species: human | Application: IHC
  66. LINC00313 facilitates osteosarcoma carcinogenesis and metastasis through enhancing EZH2 mRNA stability and EZH2-mediated silence of PTEN expression.
    Journal: Cell Mol Life Sci | Authors: Chun-Yang Xing | Species: human | Application: RIP
  67. ALS-FUS pathology revisited: singleton FUS mutations and an unusual case with both a FUS and TARDBP mutation.
    Journal: Acta Neuropathol Commun | Authors: Andrew King | Species: human | Application: IHC
  68. A new design of a lentiviral shRNA vector with inducible co-expression of ARGONAUTE 2 for enhancing gene silencing efficiency.
    Journal: Cell Biosci | Authors: Jiening He | Species: human | Application: WB
  69. Deletion of the Saccharomyces cerevisiae RACK1 homolog, ASC1, enhances autophagy which mitigates TDP-43 toxicity.
    Journal: Genetics | Authors: Sei-Kyoung Park | Species: yeast | Application: WB
  70. LINC00313 facilitates osteosarcoma carcinogenesis and metastasis through enhancing EZH2 mRNA stability and EZH2-mediated silence of PTEN expression.
    Journal: Cell Mol Life Sci | Authors: Chun-Yang Xing | Species: human | Application: RIP
  71. Ubiquitin-positive astrogliopathy clinically mimicking Parkinson’s disease
    Journal: Acta Neuropathol Commun | Authors: Meaghan Morris | Species: human | Application: IHC
  72. Curcumin inhibits liquid-liquid phase separation of fused in sarcoma and attenuates the sequestration of pyruvate kinase to restore cellular metabolism
    Journal: Food Funct | Authors: Wen-Pu Shi | Species: mouse,human | Application: WB,IF
  73. FUS inclusions disrupt RNA localization by sequestering kinesin-1 and inhibiting microtubule detyrosination.
    Journal: J Cell Biol | Authors: Kyota Yasuda | Species: human | Application: WB,IF
  74. Novel extracellular vesicle release pathway facilitated by toxic superoxide dismutase 1 oligomers.
    Journal: Neurobiol Dis | Authors: Brianna Hnath | Species: human | Application: WB,ELISA
  75. Pathologic changes in neuronal intranuclear inclusion disease are linked to aberrant FUS interaction under hyperosmotic stress
    Journal: Neurobiol Dis | Authors: Hui Wang | Species: human | Application: WB,IF
  76. The nuclear import receptor Kapβ2 modifies neurotoxicity mediated by poly(GR) in C9orf72-linked ALS/FTD
    Journal: Commun Biol | Authors: M E Cicardi | Species: human | Application: WB
  77. circLRCH3-FUS interaction stabilizes IFI35 mRNA, inhibiting autophagy and aggravating podocyte pyroptosis in lupus nephritis
    Journal: Int Immunopharmacol | Authors: Lihua Zhang | Species: human | Application: RIP
  78. FUS Mutation Causes Disordered Lipid Metabolism in Skeletal Muscle Associated with ALS
    Journal: Mol Neurobiol | Authors: Binbin Zhou | Species: mouse | Application: WB
  79. FUS Mutation Causes Disordered Lipid Metabolism in Skeletal Muscle Associated with ALS
    Journal: Mol Neurobiol | Authors: Binbin Zhou | Species: mouse | Application: WB
  80. All-Trans Retinoic Acid Exerts Neuroprotective Effects in Amyotrophic Lateral Sclerosis-Like Tg (SOD1*G93A)1Gur Mice.
    Journal: Mol Neurobiol | Authors: Yu Zhu | Species: mouse | Application: WB
  81. Patterns of glucose hypometabolism can help differentiate FTLD-FET from other types of FTLD
    Journal: J Neurol | Authors: Danna P Garcia-Guaqueta | Species: human | Application: IHC
  82. LncRNA NORAD Promotes Vascular Endothelial Cell Injury and Atherosclerosis Through Suppressing VEGF Gene Transcription via Enhancing H3K9 Deacetylation by Recruiting HDAC6.
    Journal: Front Cell Dev Biol | Authors: Huihua Kai | Species: human | Application: CoIP
  83. Tauopathy with hippocampal 4-repeat tau immunoreactive spherical inclusions: a report of three cases.
    Journal: Brain Pathol | Authors: Gabor G Kovacs
  84. Two herpesviral noncoding PAN RNAs are functionally homologous but do not associate with common chromatin loci.
    Journal: PLoS Pathog | Authors: Johanna B Withers | Species: human | Application: WB
  85. Two herpesviral noncoding PAN RNAs are functionally homologous but do not associate with common chromatin loci.
    Journal: PLoS Pathog | Authors: Johanna B Withers | Species: human | Application: WB
  86. Identification of a novel interaction of FUS and syntaphilin may explain synaptic and mitochondrial abnormalities caused by ALS mutations.
    Journal: Sci Rep | Authors: Shaakir Salam | Species: rat | Application: IF
  87. Rapid in vitro quantification of TDP-43 and FUS mislocalisation for screening of gene variants implicated in frontotemporal dementia and amyotrophic lateral sclerosis.
    Journal: Sci Rep | Authors: Lisa J Oyston | Species: human | Application: IHC
  88. Proteomic analysis of heat-stable proteins revealed an increased proportion of proteins with compositionally biased regions.
    Journal: Sci Rep | Authors: Hongsun Park | Species: mouse | Application: WB
  89. FUS aggregation following ischemic stroke favors brain astrocyte activation through inducing excessive autophagy.
    Journal: Exp Neurol | Authors: Shusheng Wu | Species: mouse | Application: WB,IF
  90. Mutant FUS induces chromatin reorganization in the hippocampus and alters memory processes
    Journal: Prog Neurobiol | Authors: Laura Tzeplaeff | Species: mouse | Application: WB,IHC
  91. Interaction of BACH2 with FUS promotes malignant progression of glioma cells via the TSLNC8-miR-10b-5p-WWC3 pathway.
    Journal: Mol Oncol | Authors: Yang Yang | Species: human | Application: WB
  92. LINC00205 promotes malignancy in lung cancer by recruiting FUS and stabilizing CSDE1.
    Journal: Biosci Rep | Authors: Peng Xie | Species: human | Application: WB
  93. Super-Resolution Microscopy Reveals Presynaptic Localization of the ALS/FTD Related Protein FUS in Hippocampal Neurons.
    Journal: Front Cell Neurosci | Authors: Michael Schoen | Species: rat | Application: IF
  94. Contrasting pathology of the stress granule proteins TIA-1 and G3BP in tauopathies.
    Journal: J Neurosci | Authors: Vanderweyde Tara T | Species: mouse,human | Application: WB,IHC
  95. FUS contributes to mTOR-dependent inhibition of translation
    Journal: J Biol Chem | Authors: Myriam Sévigny | Species: human | Application: WB
  96. FUS/TLS suppresses enterovirus replication and promotes antiviral innate immune responses.
    Journal: J Virol | Authors: Yuan Chao Xue | Species: human | Application: WB,IF
  97. FUS contributes to mTOR-dependent inhibition of translation.
    Journal: J Biol Chem | Authors: Myriam Sévigny | Species: human | Application: WB
  98. LINC00673-V4 Promotes Colorectal Cancer Cell Proliferation by Interacting With FUS and Restoring the Expression of Hippo-YAP Target Genes.
    Journal: Front Biosci (Landmark Ed) | Authors: Wei Lu
  99. Impact of histone deacetylase inhibition and arimoclomol on heat shock protein expression and disease biomarkers in primary culture models of familial ALS
    Journal: Cell Stress Chaperones | Authors: Mario Fernández Comaduran | Species: mouse | Application: IF
  100. Depending on the stress, histone deacetylase inhibitors act as heat shock protein co-inducers in motor neurons and potentiate arimoclomol, exerting neuroprotection through multiple mechanisms in ALS models.
    Journal: Cell Stress Chaperones | Authors: Rachel Kuta | Species: mouse | Application: IF
  101. The mTORC2/AKT/VCP axis is associated with quality control of the stalled translation of poly(GR) dipeptide repeats in C9-ALS/FTD
    Journal: J Biol Chem | Authors: Yu Li | Species: human | Application: WB
  102. FUS/TLS suppresses enterovirus replication and promotes antiviral innate immune responses.
    Journal: J Virol | Authors: Yuan Chao Xue | Species: human | Application: WB,IF
  103. Mutant FUS induces endoplasmic reticulum stress in amyotrophic lateral sclerosis and interacts with protein disulfide-isomerase.
    Journal: Neurobiol Aging | Authors: Farg Manal A MA | Species: mouse,human | Application: IHC,IF
  104. A Deletion of the Nuclear Localization Signal Domain in the Fus Protein Induces Stable Post-stress Cytoplasmic Inclusions in SH-SY5Y Cells.
    Journal: Front Neurosci | Authors: Antonietta Notaro | Species: human | Application: WB,IF
  105. Contribution of RNA/DNA Binding Protein Dysfunction in Oligodendrocytes in the Pathogenesis of the Amyotrophic Lateral Sclerosis/Frontotemporal Lobar Degeneration Spectrum Diseases.
    Journal: Front Neurosci | Authors: Chiara F Valori | Species: human | Application: IHC
  106. ALS-Related Mutant FUS Protein Is Mislocalized to Cytoplasm and Is Recruited into Stress Granules of Fibroblasts from Asymptomatic FUS P525L Mutation Carriers.
    Journal: Neurodegener Dis | Authors: Margherita Lo Bello | Species: human | Application: WB,IF
  107. Shared Molecular Mechanisms in Alzheimer's Disease and Amyotrophic Lateral Sclerosis: Neurofilament-Dependent Transport of sAPP, FUS, TDP-43 and SOD1, with Endoplasmic Reticulum-Like Tubules.
    Journal: Neurodegener Dis | Authors: Virgil Muresan | Species: human | Application: WB,IF
  108. Hsa_circ_0006232 promotes laryngeal squamous cell cancer progression through FUS-mediated EZH2 stabilization.
    Journal: Cell Cycle | Authors: Tianyi Wu | Species: human | Application: RIP
  109. Novel stress granules-like structures are induced via a paracrine mechanism during viral infection.
    Journal: J Cell Sci | Authors: Valentina Iadevaia | Application: IF
  110. Hsa_circ_0006232 promotes laryngeal squamous cell cancer progression through FUS-mediated EZH2 stabilization.
    Journal: Cell Cycle | Authors: Tianyi Wu | Species: human | Application: RIP
  111. Novel miR-b2122 regulates several ALS-related RNA-binding proteins.
    Journal: Mol Brain | Authors: Zachary C E Hawley | Species: human | Application: WB
  112. Molecular determinants of cytochrome C oxidase IV mRNA axonal trafficking.
    Journal: Mol Cell Neurosci | Authors: Amar N Kar | Species: rat | Application: WB,IF
  113. Widespread Mislocalization of FUS Is Associated With Mitochondrial Abnormalities in Skeletal Muscle in Amyotrophic Lateral Sclerosis With FUS Mutations.
    Journal: J Neuropathol Exp Neurol | Authors: Meng Yu | Species: human | Application: WB,IHC,IF
  114. Spinal Cord and Motor Neuron TDP-43 Pathology in a Sporadic Inclusion Body Myositis Patient.
    Journal: J Neuropathol Exp Neurol | Authors: Sahara J Cathcart | Species: human | Application: IHC
  115. Spinal Cord and Motor Neuron TDP-43 Pathology in a Sporadic Inclusion Body Myositis Patient.
    Journal: J Neuropathol Exp Neurol | Authors: Sahara J Cathcart | Species: human | Application: IHC
  116. Characteristic Features of FUS Inclusions in Spinal Motor Neurons of Sporadic Amyotrophic Lateral Sclerosis.
    Journal: J Neuropathol Exp Neurol | Authors: Kensuke Ikenaka | Species: human | Application: WB,IF
  117. Pathological features of FTLD-FUS in a Japanese population: Analyses of nine cases.
    Journal: J Neurol Sci | Authors: Kobayashi Zen Z | Species: human | Application: IHC
  118. LINC00473 mediates cyclin D1 expression through a balance between activation and repression signals in breast cancer cells.
    Journal: FEBS Lett | Authors: Xiangmin Shi | Species: human | Application: chIP
  119. Long non-coding RNA MALAT1 triggers ferroptosis via interaction with FUS to enhance ACSF2 mRNA stabilization in septic acute kidney injury
    Journal: Kaohsiung J Med Sci | Authors: Zhi-Bing Duan | Species: human | Application: WB,RIP
  120. Cytoplasmic sequestration of FUS/TLS associated with ALS alters histone marks through loss of nuclear protein arginine methyltransferase 1.
    Journal: Hum Mol Genet | Authors: Michael Tibshirani | Species: mouse,human | Application: IF
  121. PINK1 and Parkin are genetic modifiers for FUS-induced neurodegeneration.
    Journal: Hum Mol Genet | Authors: Yanbo Chen | Application: WB
  122. Pathological features of FTLD-FUS in a Japanese population: Analyses of nine cases.
    Journal: J Neurol Sci | Authors: Kobayashi Zen Z | Species: human | Application: IHC
  123. Dysregulation of chromatin remodelling complexes in amyotrophic lateral sclerosis.
    Journal: Hum Mol Genet | Authors: Michael Tibshirani | Species: mouse | Application: IF
  124. LINC00473 mediates cyclin D1 expression through a balance between activation and repression signals in breast cancer cells.
    Journal: FEBS Lett | Authors: Xiangmin Shi | Species: human | Application: chIP
  125. Characterization of the protein expression and localization of hnRNP family members during murine spermatogenesis
    Journal: Asian J Androl | Authors: Shui-Qiao Q Yuan | Species: mouse | Application: WB
  126. Abundant co-pathologies of polyglucosan bodies, frontotemporal lobar degeneration with TDP-43 inclusions, and ageing-related tau astrogliopathy in a family with a GBE1 mutation
    Journal: Neuropathol Appl Neurobiol | Authors: Maiko T Uemura | Species: human | Application: IHC
  127. Rational Design of a Multivalent RNA Combining Structural Motifs Tailored to Multiple Domains of Fused in Sarcoma for Potent Inhibition of Aggregation.
    Journal: Chembiochem | Authors: Nobuaki Kuroiwa | Species: mouse | Application: WB
  128. RBM45 modulates the antioxidant response in ALS through interactions with KEAP1.
    Journal: Mol Cell Biol | Authors: Nadine Bakkar | Species: human | Application: WB
  129. Iron accumulation in deep cortical layers accounts for MRI signal abnormalities in ALS: correlating 7 tesla MRI and pathology.
    Journal: PLoS One | Authors: Kwan Justin Y JY | Species: human | Application: IHC
  130. CircPRMT5 promotes progression of osteosarcoma by recruiting CNBP to regulate the translation and stability of CDK6 mRNA
    Journal: PLoS One | Authors: Yunlu Liu | Species: human | Application: IP
  131. Mutant Human FUS Is Ubiquitously Mislocalized and Generates Persistent Stress Granules in Primary Cultured Transgenic Zebrafish Cells.
    Journal: PLoS One | Authors: Jamie Rae Acosta | Species: human | Application: WB,IF
  132. Cytoplasmic accumulation and aggregation of TDP-43 upon proteasome inhibition in cultured neurons.
    Journal: PLoS One | Authors: van Eersel Janet J | Species: mouse | Application: IHC,IF
  133. Role of thrombus-derived exosomal lncRNA LOC101928697 in regulating endothelial function via FUS protein interaction in myocardial infarction.
    Journal: Sci Prog | Authors: Youfu He | Species: human | Application: WB
  134. The role of JPX in regulating FUS/SLC7A11 signaling pathway mediated ferroptosis in keloid fibroblasts and its potential in scar repair
    Journal: Biochem Biophys Res Commun | Authors: Jianhui Tang | Species: human | Application: RIP
  135. Early lethality and neuronal proteinopathy in mice expressing cytoplasm-targeted FUS that lacks the RNA recognition motif.
    Journal: Amyotroph Lateral Scler Frontotemporal Degener | Authors: Hannah K Robinson | Application: IHC
  136. Attenuation of Activated eIF2α Signaling by ISRIB Treatment After Spinal Cord Injury Improves Locomotor Function.
    Journal: J Mol Neurosci | Authors: Lei Chang | Species: mouse | Application: WB
  137. HOTAIRM1 Maintained the Malignant Phenotype of tMSCs Transformed by GSCs via E2F7 by Binding to FUS.
    Journal: J Oncol | Authors: Liang Liu | Species: mouse | Application: WB
  138. Elevated FUS/TLS expression is negatively associated with E-cadherin expression and prognosis of patients with non-small cell lung cancer.
    Journal: Oncol Lett | Authors: Dian Xiong | Species: human | Application: WB,IHC,IF
  139. Protein complexes from mouse and chick brain that interact with phospho-KXGS motif tau/microtubule associated protein antibody
    Journal: Biol Open | Authors: Danielle Davies | Species: chicken | Application: IF
  140. Functional domains of the FSHD-associated DUX4 protein.
    Journal: Biol Open | Authors: Hiroaki Mitsuhashi | Species: human | Application: WB
  141. Praja1 RING-finger E3 ubiquitin ligase is a common suppressor of neurodegenerative disease-associated protein aggregation.
    Journal: Neuropathology | Authors: Kazuhiko Watabe | Species: rat | Application: CoIP
  142. Neuropathologic findings in a patient with hemiparkinsonism and hemiatrophy syndrome
    Journal: Neuropathology | Authors: Masataka Nakamura | Species: human | Application: IHC
  143. Atypical FTLD-FUS associated with ALS-TDP: a case report.
    Journal: Neuropathology | Authors: Kobayashi Zen Z | Species: human | Application: IHC
  144. An autopsy case report of neuronal intermediate filament inclusion disease presenting with predominantly upper motor neuron features.
    Journal: Neuropathology | Authors: Aya Murakami | Species: human | Application: IHC
  145. The identification of high-performing antibodies for RNA-binding protein FUS for use in Western Blot, immunoprecipitation, and immunofluorescence
    Journal: F1000Res | Authors: Walaa Alshalfie | Species: human | Application: WB,IP,IF
  146. Localized synthesis of molecular chaperones sustains neuronal proteostasis
    Journal: bioRxiv | Authors: Celia Alecki | Species: human | Application: WB,IF
  147. Defining RNA oligonucleotides that reverse deleterious phase transitions of RNA-binding proteins with prion-like domains
    Journal: bioRxiv | Authors: Lin Guo | Species: human | Application: IF
  148. Proteomic Screening Identifies HNRNPA2B1 as an Epigenetic Repressor of Epstein-Barr Virus Reactivation.
    Journal: bioRxiv | Authors: Febri Gunawan Sugiokto | Species: human | Application: WB
  149. The lncRNA Neat1 is associated with astrocyte reactivity and memory deficits in a mouse model of Alzheimer's disease
    Journal: bioRxiv | Authors: Ashleigh B Irwin | Species: mouse | Application: WB
  150. Deletion of the Saccharomyces cerevisiae RACK1 homolog, ASC1 , enhances autophagy which mitigates TDP-43 toxicity
    Journal: bioRxiv | Authors: Sei-Kyoung Park
  151. Defining RNA oligonucleotides that reverse deleterious phase transitions of RNA-binding proteins with prion-like domains
    Journal: bioRxiv | Authors: Lin Guo | Species: human | Application: IF
  152. Localized synthesis of molecular chaperones sustains neuronal proteostasis
    Journal: bioRxiv | Authors: Celia Alecki | Species: human | Application: WB,IF
  153. Proteomic Screening Identifies HNRNPA2B1 as an Epigenetic Repressor of Epstein-Barr Virus Reactivation.
    Journal: bioRxiv | Authors: Febri Gunawan Sugiokto | Species: human | Application: WB
  154. YTHDC1 functions as a molecular chaperone to suppress ALS-linked hnRNPA1 mutants from aggregation.
    Journal: Nat Commun | Authors: Kang Ren

Reviews

Write Your Own Review
You're reviewing:FUS/TLS Polyclonal antibody 11570-1-AP proteintech
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.