GGCX Polyclonal antibody 16209-1-AP proteintech
$149.00
In stock
SKU
16209-1-AP
| Catalog Number | 16209-1-AP |
| Synonyms | gamma glutamyl carboxylase, GC, GGCX, VKCFD1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF7 cells, HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue, PC-3 cells |
| Tested Applications — Positive IP detected in | mouse liver tissue |
| Tested Applications — Positive IHC detected in | human liver tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | MCF7 cells, HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue, PC-3 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9185 Product name: Recombinant human GGCX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 383-758 aa of BC013979 Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF Predict reactive species |
| Full Name | gamma-glutamyl carboxylase |
| Calculated Molecular Weight | 758 aa, 88 kDa |
| Observed Molecular Weight | 88 kDa |
| GenBank Accession Number | BC013979 |
| Gene Symbol | GGCX |
| Gene ID (NCBI) | 2677 |
| RRID | AB_2110874 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38435 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for GGCX antibody 16209-1-AP | Download protocol |
| IP protocol for GGCX antibody 16209-1-AP | Download protocol |
| WB protocol for GGCX antibody 16209-1-AP | Download protocol |
| mouse | WB J Cell Biol GGCX and VKORC1 inhibit osteocalcin endocrine functions. Authors - Mathieu Ferron View Article |
| human | WB JCI Insight VKOR paralog VKORC1L1 supports vitamin K-dependent protein carboxylation in vivo. Authors - Julie Lacombe View Article |
| mouse,pig | WB,IP Nat Commun GGCX promotes Eurasian avian-like H1N1 swine influenza virus adaption to interspecies receptor binding Authors - Jiahui Zou KD Validated View Article |
| Citations | 12 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937). Protocols Product Specific Protocols IHC protocol for GGCX antibody 16209-1-AP Download protocol IP protocol for GGCX antibody 16209-1-AP Download protocol WB protocol for GGCX antibody 16209-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- GGCX and VKORC1 inhibit osteocalcin endocrine functions.
Journal: J Cell Biol | Authors: Mathieu Ferron | Species: mouse | Application: WB - Characterization of vitamin K-dependent carboxylase mutations that cause bleeding and nonbleeding disorders.
Journal: Blood | Authors: Jian-Ke Tie - Functional Study of the Vitamin K Cycle Enzymes in Live Cells.
Journal: Methods Enzymol | Authors: J-K Tie KO Validated | Species: human | Application: WB - VKOR paralog VKORC1L1 supports vitamin K-dependent protein carboxylation in vivo.
Journal: JCI Insight | Authors: Julie Lacombe | Species: human | Application: WB - GGCX promotes Eurasian avian-like H1N1 swine influenza virus adaption to interspecies receptor binding
Journal: Nat Commun | Authors: Jiahui Zou KD Validated | Species: mouse,pig | Application: WB,IP - Molecular basis of vitamin K driven γ-carboxylation at membrane interface
Journal: Nature | Authors: Qing Cao - Modification of Gas6 Protein in the Brain by a Functional Endogenous Tissue Vitamin K Cycle
Journal: Cells | Authors: Nadide Aydin | Species: mouse | Application: WB - Low phylloquinone intake deteriorates endothelial function in normolipidemic and dyslipidaemic mice
Journal: J Nutr Biochem | Authors: Agnieszka Kij | Species: mouse | Application: IHC - The GgcxK325Q Mutation Does Not Affect the Calcium Homeostasis of the Epididymis and Male Fertility in Mice
Journal: Curr Issues Mol Biol | Authors: Mingxiang Xiong | Species: mouse | Application: WB,IF - Assessment of gamma-glutamyl carboxylase activity in its native milieu
Journal: Methods Enzymol | Authors: Xuejie Chen | Species: human | Application: WB - Functional Study of the Vitamin K Cycle Enzymes in Live Cells.
Journal: Methods Enzymol | Authors: J-K Tie | Species: human | Application: WB - Divergent effects of vitamins K1 and K2 on triple negative breast cancer cells.
Journal: Oncotarget | Authors: Sarah Beaudin | Species: human | Application: WB - Molecular basis of vitamin K-dependent protein γ-glutamyl carboxylation.
Journal: Cell Res | Authors: Qihang Zhong
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
