GHRL/Ghrelin Polyclonal antibody 13309-1-AP proteintech
$149.00
In stock
SKU
13309-1-AP
| Catalog Number | 13309-1-AP |
| Synonyms | Ghrelin, GHRL, Appetite regulating hormone, Appetite-regulating hormone, Ghrelin-27 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human stomach tissue |
| Tested Applications — Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Positive WB detected in | human stomach tissue |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4141 Product name: Recombinant human GHRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-117 aa of BC025791 Sequence: LSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Predict reactive species |
| Full Name | ghrelin/obestatin prepropeptide |
| Calculated Molecular Weight | 117 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC025791 |
| Gene Symbol | GHRL |
| Gene ID (NCBI) | 51738 |
| RRID | AB_2294726 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBU3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for GHRL/Ghrelin antibody 13309-1-AP | Download protocol |
| WB protocol for GHRL/Ghrelin antibody 13309-1-AP | Download protocol |
| rat | WB Hepatobiliary Pancreat Dis Int Ghrelin inhibits IKKβ/NF-κB activation and reduces pro-inflammatory cytokine production in pancreatic acinar AR42J cells treated with cerulein. Authors - Ren-Jie Chang View Article |
| human | IHC Biosci Rep Differential expression of ghrelin and GHSR via the mTOR pathway during the dynamic carcinogenic process involving oral, potentially malignant disorders. Authors - Jianing Lou View Article |
| mouse | IHC Front Immunol Inhibition of the MyD88 signaling pathway could upregulates Ghrelin expression to synergistically regulate hepatic Echinococcus multilocularis-infected progression Authors - Jiang Zhu View Article |
| Citations | 9 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:600-1:2400 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GHRL encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is predominantly produced in endocrine cells in the gastric mucosa, called X/A-like or ghrelin cells, from where it is secreted into the plasma. In the pituitary gland, ghrelin stimulates GH release and regulates food intake and energy metabolism. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Protocols Product Specific Protocols IHC protocol for GHRL/Ghrelin antibody 13309-1-AP Download protocol WB protocol for GHRL/Ghrelin antibody 13309-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Differential effect of polysaccharide and nonpolysaccharide components in Sijunzi decoction on spleen deficiency syndrome and their mechanisms.
Journal: Phytomedicine | Authors: Ping Ma | Species: rat | Application: WB - Effects of Ghrelin miRNA on Inflammation and Calcium Pathway in Pancreatic Acinar Cells of Acute Pancreatitis
Journal: Pancreas | Authors: View Article | Species: rat | Application: WB - Differential expression of ghrelin and GHSR via the mTOR pathway during the dynamic carcinogenic process involving oral, potentially malignant disorders.
Journal: Biosci Rep | Authors: Jianing Lou | Species: human | Application: IHC - Expression of ghrelin or growth hormone secretagogue receptor in the brain of postpartum stress mice.
Journal: Neuroreport | Authors: Jing-Wei Xing | Species: mouse | Application: IHC - Ghrelin inhibits IKKβ/NF-κB activation and reduces pro-inflammatory cytokine production in pancreatic acinar AR42J cells treated with cerulein.
Journal: Hepatobiliary Pancreat Dis Int | Authors: Ren-Jie Chang | Species: rat | Application: WB - Inhibition of the MyD88 signaling pathway could upregulates Ghrelin expression to synergistically regulate hepatic Echinococcus multilocularis-infected progression
Journal: Front Immunol | Authors: Jiang Zhu | Species: mouse | Application: IHC - Expression of ghrelin or growth hormone secretagogue receptor in the brain of postpartum stress mice.
Journal: Neuroreport | Authors: Jing-Wei Xing | Species: mouse | Application: IHC - Spatiotemporal dynamics of lineage-specific epithelial maturation in the developing mouse stomach.
Journal: Int J Dev Biol | Authors: Masashi Nishide - Effect of Vitamin D Combined with Recombinant Human Growth Hormone in Children with Growth Hormone Deficiency.
Journal: Dis Markers | Authors: Pingping Wang | Species: human | Application: ELISA
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
