GLB1L3 Polyclonal antibody 20159-1-AP proteintech
$149.00
In stock
SKU
20159-1-AP
| Catalog Number | 20159-1-AP |
| Synonyms | galactosidase, beta 1 like 3, GLB1L3 |
| Host | Rabbit |
| Reactivity | mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue, rat testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14083 Product name: Recombinant human GLB1L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC011001 Sequence: MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIF Predict reactive species |
| Full Name | galactosidase, beta 1-like 3 |
| Calculated Molecular Weight | 653 aa, 75 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC011001 |
| Gene Symbol | GLB1L3 |
| Gene ID (NCBI) | 112937 |
| RRID | AB_3669325 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NCI6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for GLB1L3 antibody 20159-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Glb1l3 is a member of the glycosyl hydrolase 35 family of proteins. These proteins display hydrolase activity catalyzing the cleavage of lactose, as well as galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans (PMID: 21633714). Glb1l3 has 3 isoforms produced by alternative splicing, which is 75kDa, 36kDa and 35kDa. Protocols Product Specific Protocols WB protocol for GLB1L3 antibody 20159-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
