GLP1R Monoclonal antibody, PBS Only (Detector) 60931-2-PBS proteintech
$699.00
In stock
SKU
60931-2-PBS
| Catalog Number | 60931-2-PBS |
| Synonyms | GLP 1 R, GLP 1 receptor, GLP 1R, GLP-1 receptor, GLP-1R |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23529 Product name: Recombinant human GLP1R protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 26-145 aa of BC112126 Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Predict reactive species |
| Full Name | glucagon-like peptide 1 receptor |
| Calculated Molecular Weight | 463 aa, 53 kDa |
| GenBank Accession Number | BC112126 |
| Gene Symbol | GLP1R |
| Gene ID (NCBI) | 2740 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P43220 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 1A7C3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
