GNG13 Polyclonal antibody 18223-1-AP proteintech
$149.00
In stock
SKU
18223-1-AP
| Catalog Number | 18223-1-AP |
| Synonyms | h2 35, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13, G(gamma)13 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, mouse retina tissue, rat brain tissue, rat retina tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Positive WB detected in | mouse brain tissue, mouse retina tissue, rat brain tissue, rat retina tissue |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag13007 Product name: Recombinant human GNG13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC093760 Sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL Predict reactive species |
| Full Name | guanine nucleotide binding protein (G protein), gamma 13 |
| Calculated Molecular Weight | 67 aa, 8 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC093760 |
| Gene Symbol | GNG13 |
| Gene ID (NCBI) | 51764 |
| RRID | AB_3741949 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P2W3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for GNG13 antibody 18223-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:3000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GNG13 (Guanine nucleotide-binding protein G (G gamma 13)) is a gene that encodes a gamma subunit of a heterotrimeric G protein. It is expressed in taste, retinal, and neuronal tissues and is crucial for taste transduction. In the main olfactory epithelium (MOE), most olfactory sensory neurons (OSNs) express G proteins consisting of Gαolf and Gβ1γ13. Conditional knockout of the Gng13 gene in mice significantly altered the MOE's gene expression profile and impaired the mutant animals' food - seeking capabilities (PMID: 30157062). Protocols Product Specific Protocols WB protocol for GNG13 antibody 18223-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
