GNG3 Polyclonal antibody 26892-1-AP proteintech
$149.00
In stock
SKU
26892-1-AP
| Catalog Number | 26892-1-AP |
| Synonyms | GNG3, GNGT3 |
| Host | Rabbit |
| Reactivity | Mouse, Rat |
| Reactivity | mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Tested Reactivity | Mouse, Rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25341 Product name: Recombinant human GNG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC015563 Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT Predict reactive species |
| Full Name | guanine nucleotide binding protein (G protein), gamma 3 |
| Calculated Molecular Weight | 8 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC015563 |
| Gene Symbol | GNG3 |
| Gene ID (NCBI) | 2785 |
| RRID | AB_3085915 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63215 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for GNG3 antibody 26892-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:3000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GNG3, also named as GNGT3, belongs to the G protein gamma family. G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins. GNG3 is predominantly expressed in the brain, where its expression increases during postnatal development. Protocols Product Specific Protocols WB protocol for GNG3 antibody 26892-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
