GNGT2 Recombinant monoclonal antibody, PBS Only 86284-1-PBS proteintech
$699.00
In stock
SKU
86284-1-PBS
| Catalog Number | 86284-1-PBS |
| Synonyms | G gamma-C, G-gamma-8, G-gamma-9, GNG8, GNG9 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg4093 Product name: Recombinant human GNGT2 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-69 aa of BC008663 Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS Predict reactive species |
| Full Name | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 |
| Calculated Molecular Weight | 69 aa, 8 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC008663 |
| Gene Symbol | GNGT2 |
| Gene ID (NCBI) | 2793 |
| RRID | AB_3744781 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O14610 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250794F8 |
| Conjugation | Unconjugated |
GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
