GPR56 Recombinant monoclonal antibody, PBS Only (Detector) 84915-2-PBS proteintech
$699.00
In stock
SKU
84915-2-PBS
| Catalog Number | 84915-2-PBS |
| Synonyms | ADGRG1, ADGRG1 CT, ADGRG1 C-terminal fragment, ADGRG1 NT, ADGRG1 N-terminal fragment |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2478 Product name: Recombinant Human GPR56 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-171 aa of NM_001145771.2 Sequence: RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHN Predict reactive species |
| Full Name | G protein-coupled receptor 56 |
| Calculated Molecular Weight | 78 kDa |
| GenBank Accession Number | NM_001145771.2 |
| Gene Symbol | GPR56 |
| Gene ID (NCBI) | 9289 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y653 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242249C5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
