GPSM2 Recombinant monoclonal antibody 86175-1-RR proteintech
$149.00
In stock
SKU
86175-1-RR
| Catalog Number | 86175-1-RR |
| Synonyms | G protein signaling modulator 2, G-protein-signaling modulator 2, LGN, Pins |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, mouse liver tissue, rat liver tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, mouse liver tissue, rat liver tissue |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25195 Product name: Recombinant human GPSM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 559-600 aa of BC027732 Sequence: FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS Predict reactive species |
| Full Name | G-protein signaling modulator 2 (AGS3-like, C. elegans) |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 70-77 kDa |
| GenBank Accession Number | BC027732 |
| Gene Symbol | GPSM2 |
| Gene ID (NCBI) | 29899 |
| RRID | AB_3744684 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P81274 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for GPSM2 antibody 86175-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250793G2 |
| Conjugation | Unconjugated |
GPSM2 belongs to a family of proteins that modulate activation of G proteins. GPSM2 assists in the exchange of guanine nucleotides, and allows extracellular signals to be transmitted to cells via cell surface, and ultimately plays a key role in the activation of G-proteins. Therefore, GPSM2 is a critical factor for the stability of cell division. Some recent studies have shown that GPSM2 messenger RNA (mRNA) is overexpressed and plays a positive role in the development of certain tumors, such as liver cancer, pancreatic cancer, breast cancer. It also plays a role in neuroblast division and in the development of normal hearing. Mutations in GPSM2 are associated with autosomal recessive nonsyndromic deafness (DFNB82), which is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss. Protocols Product Specific Protocols WB protocol for GPSM2 antibody 86175-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
