Galectin-3 Recombinant monoclonal antibody 82024-1-RR proteintech
$149.00
In stock
SKU
82024-1-RR
| Catalog Number | 82024-1-RR |
| Synonyms | 35 kDa lectin, Carbohydrate-binding protein 35, CBP 35, CBP35, Gal 3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, rat colon tissue, MCF-7 cells, A549 cells, A431 cells, NIH/3T3 cells, C6 cells |
| Tested Applications — Positive IP detected in | MCF-7 cells |
| Tested Applications — Positive IHC detected in | human thyroid cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Positive WB detected in | HeLa cells, rat colon tissue, MCF-7 cells, A549 cells, A431 cells, NIH/3T3 cells, C6 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human thyroid cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag6891 Product name: Recombinant human Galectin 3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC001120 Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI Predict reactive species |
| Full Name | lectin, galactoside-binding, soluble, 3 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC001120 |
| Gene Symbol | Galectin-3 |
| Gene ID (NCBI) | 3958 |
| RRID | AB_2935599 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P17931 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Galectin-3 antibody 82024-1-RR | Download protocol |
| IHC protocol for Galectin-3 antibody 82024-1-RR | Download protocol |
| IP protocol for Galectin-3 antibody 82024-1-RR | Download protocol |
| WB protocol for Galectin-3 antibody 82024-1-RR | Download protocol |
| human | WB Biomater Res Versatile Nanotherapeutics for Enhancing Sonodynamic Therapy/Chemotherapy of Thyroid Cancer through Remodeling Tumor Microenvironment and Synergistic Reactive Oxygen Species Augment. Authors - Dan Wang View Article |
| mouse, human | IF Autophagy High-fat diet exacerbates experimental colitis by inhibiting lysosomal function via the STAT3-TFEB Axis. Authors - Haodong He KD Validated View Article |
| Citations | 8 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:250-1:1000 IF/ICC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 4M10 |
| Conjugation | Unconjugated |
Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078). Protocols Product Specific Protocols IF protocol for Galectin-3 antibody 82024-1-RR Download protocol IHC protocol for Galectin-3 antibody 82024-1-RR Download protocol IP protocol for Galectin-3 antibody 82024-1-RR Download protocol WB protocol for Galectin-3 antibody 82024-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- HEY1-NCOA2 expression modulates chondrogenic differentiation and induces mesenchymal chondrosarcoma in mice
Journal: JCI Insight | Authors: Miwa Tanaka | Species: human | Application: IHC - LAPTM5 confers cisplatin resistance in NSCLC by suppressing LAMP1 ubiquitination to stabilize lysosomal membranes and sustain autophagic flux
Journal: Cell Signal | Authors: Fan Wu | Species: human | Application: WB - Chaperone-mediated autophagy directs a dual mechanism to balance premature senescence and senolysis to prevent intervertebral disc degeneration
Journal: Bone Res | Authors: Zhangrong Cheng | Species: human | Application: IF - High-fat diet exacerbates experimental colitis by inhibiting lysosomal function via the STAT3-TFEB Axis.
Journal: Autophagy | Authors: Haodong He KD Validated | Species: mouse, human | Application: IF - Galectin-3 directs mitophagy in response to Parkin-/proteasome-dependent rupture of mitochondrial outer membrane.
Journal: Biol Direct | Authors: Pei-Han Liu | Species: human | Application: IF - Versatile Nanotherapeutics for Enhancing Sonodynamic Therapy/Chemotherapy of Thyroid Cancer through Remodeling Tumor Microenvironment and Synergistic Reactive Oxygen Species Augment.
Journal: Biomater Res | Authors: Dan Wang | Species: human | Application: WB - LAPTM5 confers cisplatin resistance in NSCLC by suppressing LAMP1 ubiquitination to stabilize lysosomal membranes and sustain autophagic flux
Journal: Cell Signal | Authors: Fan Wu | Species: human | Application: WB - Galectin-receptor interaction: a key player in liver fibrosis induced by Schistosoma japonicum infection
Journal: Parasit Vectors | Authors: Ziyun Huang | Species: mouse | Application: WB,IHC,IF
Reviews
Write Your Own Review