GRIK5 Polyclonal antibody 28550-1-AP proteintech
$149.00
In stock
SKU
28550-1-AP
| Catalog Number | 28550-1-AP |
| Synonyms | EAA2, Glutamate receptor KA 2, GRIK2, GRIK5, KA2 |
| Host | Rabbit |
| Reactivity | Human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | mouse, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29363 Product name: Recombinant human GRIK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 845-980 aa of NM_001301030 Sequence: MLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE Predict reactive species |
| Full Name | glutamate receptor, ionotropic, kainate 5 |
| Calculated Molecular Weight | 109 kDa |
| Observed Molecular Weight | ~110 kDa |
| GenBank Accession Number | NM_001301030 |
| Gene Symbol | GRIK5 |
| Gene ID (NCBI) | 2901 |
| RRID | AB_3086064 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16478 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for GRIK5 antibody 28550-1-AP | Download protocol |
| WB protocol for GRIK5 antibody 28550-1-AP | Download protocol |
| zebrafish | WB Acta Pharmacol Sin Ursolic acid derivative UA312 ameliorates ionizing radiation-induced cardiotoxicity and neurodevelopmental toxicity in zebrafish via targeting chrna3 and grik5 Authors - Fei-Fei Xu View Article |
| mouse | WB Brain Res Bull Pad2 Deletion Induces Anxiety‑like Behaviors and Memory Deficits in Mice Authors - Xiaoqiang Lv View Article |
| Citations | 2 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications