B23/NPM1 Recombinant monoclonal antibody 82030-1-RR proteintech
$149.00
In stock
SKU
82030-1-RR
| Catalog Number | 82030-1-RR |
| Synonyms | B23, NPM1, 1G4, NPM, Nucleophosmin |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, THP-1 cells |
| Tested Applications — Positive IP detected in | Jurkat cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, THP-1 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human prostate cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag0286 Product name: Recombinant human B23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC002398 Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS Predict reactive species |
| Full Name | nucleophosmin (nucleolar phosphoprotein B23, numatrin) |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC002398 |
| Gene Symbol | NPM1 |
| Gene ID (NCBI) | 4869 |
| RRID | AB_2935600 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P06748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for B23/NPM1 antibody 82030-1-RR | Download protocol |
| IHC protocol for B23/NPM1 antibody 82030-1-RR | Download protocol |
| IP protocol for B23/NPM1 antibody 82030-1-RR | Download protocol |
| WB protocol for B23/NPM1 antibody 82030-1-RR | Download protocol |
| human | IF Int J Biol Macromol Silencing of human RNA polymerase I subunit A34 influences multiple cellular processes including rDNA transcription and cell migration. Authors - Xiaoye Song View Article |
| Citations | 1 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:1000-1:8000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 1G4 |
| Conjugation | Unconjugated |
Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis. Protocols Product Specific Protocols IF protocol for B23/NPM1 antibody 82030-1-RR Download protocol IHC protocol for B23/NPM1 antibody 82030-1-RR Download protocol IP protocol for B23/NPM1 antibody 82030-1-RR Download protocol WB protocol for B23/NPM1 antibody 82030-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Silencing of human RNA polymerase I subunit A34 influences multiple cellular processes including rDNA transcription and cell migration.
Journal: Int J Biol Macromol | Authors: Xiaoye Song | Species: human | Application: IF
Reviews
Write Your Own Review