Growth Hormone Polyclonal antibody 27079-1-AP proteintech
$149.00
In stock
SKU
27079-1-AP
| Catalog Number | 27079-1-AP |
| Synonyms | GH, GH1, growth hormone 1, GH-N, GH 1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human placenta tissue |
| Tested Applications — Positive IHC detected in | human pituitary adenoma tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | human placenta tissue |
| Positive IHC detected in | human pituitary adenoma tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22841 Product name: Recombinant human GH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-98 aa of BC075012 Sequence: LPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSN Predict reactive species |
| Full Name | GH1 |
| Calculated Molecular Weight | 217 aa, 25 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC075012 |
| Gene Symbol | GH1 |
| Gene ID (NCBI) | 2688 |
| RRID | AB_2880745 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01241 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Growth Hormone antibody 27079-1-AP | Download protocol |
| WB protocol for Growth Hormone antibody 27079-1-AP | Download protocol |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
GH1, also named as GH or GH-N, belongs to the somatotropin/prolactin family. GH1 plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. Protocols Product Specific Protocols IHC protocol for Growth Hormone antibody 27079-1-AP Download protocol WB protocol for Growth Hormone antibody 27079-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Production of Biopharmaceutical Proteins from Scallop Hemocytes as a Bioreactor Using Improved Transfection Conditions.
Journal: Mar Biotechnol (NY) | Authors: Taro Tsuda | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
