HBXIP Polyclonal antibody 14492-1-AP proteintech
$149.00
In stock
SKU
14492-1-AP
| Catalog Number | 14492-1-AP |
| Synonyms | HBV X interacting protein, HBV X-interacting protein, HBX interacting protein, HBX-interacting protein, Hepatitis B virus X-interacting protein |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Applications | WB, IHC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | K-562 cells, U2OS cells |
| Tested Applications — Positive IP detected in | K-562 cells |
| Tested Applications — Positive IHC detected in | human hepatocellular cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive FC (Intra) detected in | MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | K-562 cells, U2OS cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human hepatocellular cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | MCF-7 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5894 Product name: Recombinant human HBXIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC062619 Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS Predict reactive species |
| Full Name | hepatitis B virus x interacting protein |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC062619 |
| Gene Symbol | HBXIP |
| Gene ID (NCBI) | 10542 |
| RRID | AB_2878062 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A0A8Z5A536 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for HBXIP antibody 14492-1-AP | Download protocol |
| IHC protocol for HBXIP antibody 14492-1-AP | Download protocol |
| IP protocol for HBXIP antibody 14492-1-AP | Download protocol |
| WB protocol for HBXIP antibody 14492-1-AP | Download protocol |
| human | WB,IHC Am J Cancer Res Elevated HBXIP expression is associated with aggressive phenotype and poor prognosis in esophageal squamous cell carcinoma. Authors - Honggang Xia View Article |
| Citations | 13 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP has multiple isoforms with molecular weights of 8-10 kd and 18 kd. This antibody mainly recognizes the 10 kd isoform. Protocols Product Specific Protocols FC protocol for HBXIP antibody 14492-1-AP Download protocol IHC protocol for HBXIP antibody 14492-1-AP Download protocol IP protocol for HBXIP antibody 14492-1-AP Download protocol WB protocol for HBXIP antibody 14492-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity.
Journal: Autophagy | Authors: Guokai Yan | Species: human | Application: WB - Germacrone Regulates HBXIP-Mediated Cell Cycle, Apoptosis and Promotes the Formation of Autophagosomes to Inhibit the Proliferation of Gastric Cancer Cells.
Journal: Front Oncol | Authors: Xing Fang | Species: human | Application: WB - The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells.
Journal: J Biol Chem | Authors: Liu Shuangping S | Species: human | Application: WB,IP,IHC - The oncoprotein HBXIP up-regulates Skp2 via activating transcription factor E2F1 to promote proliferation of breast cancer cells.
Journal: Cancer Lett | Authors: Xu Fuqiang F KD Validated | Species: human | Application: WB,IHC - The oncoprotein hepatitis B X-interacting protein promotes the migration of ovarian cancer cells through the upregulation of S-phase kinase-associated protein 2 by Sp1.
Journal: Int J Oncol | Authors: Fuqiang Xu KD Validated | Species: human | Application: WB,IHC - Elevated HBXIP expression is associated with aggressive phenotype and poor prognosis in esophageal squamous cell carcinoma.
Journal: Am J Cancer Res | Authors: Honggang Xia | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
