HGF Recombinant monoclonal antibody, PBS Only 83453-2-PBS proteintech
$699.00
In stock
SKU
83453-2-PBS
| Catalog Number | 83453-2-PBS |
| Synonyms | HGF Alpha, Hepatocyte growth factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain, Hepatopoietin-A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25478 Product name: Recombinant human HGF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species |
| Full Name | hepatocyte growth factor (hepapoietin A; scatter factor) |
| GenBank Accession Number | BC130286 |
| Gene Symbol | HGF |
| Gene ID (NCBI) | 3082 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P14210 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240383E11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
