NCAM1/CD56 Recombinant monoclonal antibody 82715-1-RR proteintech
$149.00
In stock
SKU
82715-1-RR
| Catalog Number | 82715-1-RR |
| Synonyms | CD56, NCAM1, MSK39, N CAM 1, NCAM |
| Host | Rabbit |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | pig brain tissue, SH-SY5Y cells, U-251 cells, Neuro-2a cells, C6 cells, mouse brain tissue, rat brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human tonsillitis tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | pig brain tissue, SH-SY5Y cells, U-251 cells, Neuro-2a cells, C6 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, human tonsillitis tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag5528 Product name: Recombinant human NCAM1/CD56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-352 aa of BC047244 Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE Predict reactive species |
| Full Name | neural cell adhesion molecule 1 |
| Calculated Molecular Weight | 95 kDa |
| Observed Molecular Weight | 120 kDa, 140 kDa, 180 kDa |
| GenBank Accession Number | BC047244 |
| Gene Symbol | NCAM1 |
| Gene ID (NCBI) | 4684 |
| ENSEMBL Gene ID | ENSG00000149294 |
| RRID | AB_3086516 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P13591 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for NCAM1/CD56 antibody 82715-1-RR | Download protocol |
| IHC protocol for NCAM1/CD56 antibody 82715-1-RR | Download protocol |
| WB protocol for NCAM1/CD56 antibody 82715-1-RR | Download protocol |
| human | IHC Mol Med Crosstalk between cancer-associated fibroblasts and non-neuroendocrine tumor cells in small cell lung cancer involves in glycolysis and antigen-presenting features Authors - Yuanhua Lu View Article |
| Citations | 3 |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:200-1:1000 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 6N11 |
| Conjugation | Unconjugated |
Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291). Protocols Product Specific Protocols IF protocol for NCAM1/CD56 antibody 82715-1-RR Download protocol IHC protocol for NCAM1/CD56 antibody 82715-1-RR Download protocol WB protocol for NCAM1/CD56 antibody 82715-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Crosstalk between cancer-associated fibroblasts and non-neuroendocrine tumor cells in small cell lung cancer involves in glycolysis and antigen-presenting features
Journal: Mol Med | Authors: Yuanhua Lu | Species: human | Application: IHC - A high proportion of CD38 (high) CD16 (low) NK cells in colorectal cancer can interrupt immune surveillance and favor tumor growth
Journal: Cancer Immunol Immunother | Authors: Xueling Wang - PRKN mediates the ubiquitination of SCAF8 to reduce the mRNA stability of KLF5 and its transcriptional activation of EFNA3 in colorectal cancer.
Journal: Cell Mol Biol Lett | Authors: Ye Song
Reviews
Write Your Own Review