HIST2H2AA4 Polyclonal antibody 15302-1-AP proteintech
$149.00
In stock
SKU
15302-1-AP
| Catalog Number | 15302-1-AP |
| Synonyms | H2A/R, H2AFO, HIST2H2AA, HIST2H2AA3, HIST2H2AA4, histone, histone cluster 2, H2aa4, Histone H2A type 2 A, Histone H2A.2, Histone H2A/o |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | L02 cells, Jurkat cells, K-562 cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | L02 cells, Jurkat cells, K-562 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7560 Product name: Recombinant human HIST2H2AA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001629 Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK Predict reactive species |
| Full Name | histone cluster 2, H2aa4 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC001629 |
| Gene Symbol | HIST2H2AA4 |
| Gene ID (NCBI) | 723790 |
| RRID | AB_2878124 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6FI13 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for HIST2H2AA4 antibody 15302-1-AP | Download protocol |
| WB protocol for HIST2H2AA4 antibody 15302-1-AP | Download protocol |
| mouse | WB Cell Physiol Biochem Effect of Type I Diabetes on the Proteome of Mouse Oocytes. Authors - Guangjian Jiang View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Effect of Type I Diabetes on the Proteome of Mouse Oocytes.
Journal: Cell Physiol Biochem | Authors: Guangjian Jiang | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
