ACAP1 Recombinant monoclonal antibody 82967-4-RR proteintech
$149.00
In stock
SKU
82967-4-RR
| Catalog Number | 82967-4-RR |
| Synonyms | 230370D5, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, Centaurin beta 1, Centaurin-beta-1, CENTB1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Jurkat cells |
| Tested Applications — Positive IF/ICC detected in | Jurkat cells |
| Tested Applications — Positive FC (Intra) detected in | A431 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | Jurkat cells |
| Positive IF/ICC detected in | Jurkat cells |
| Positive FC (Intra) detected in | A431 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species |
| Full Name | ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 |
| Calculated Molecular Weight | 740 aa, 82 kDa |
| Observed Molecular Weight | 82-85 kDa |
| GenBank Accession Number | BC018543 |
| Gene Symbol | ACAP1 |
| Gene ID (NCBI) | 9744 |
| RRID | AB_3670714 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15027 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for ACAP1 antibody 82967-4-RR | Download protocol |
| IF protocol for ACAP1 antibody 82967-4-RR | Download protocol |
| WB protocol for ACAP1 antibody 82967-4-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IF/ICC : 1:500-1:2000 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230370D5 |
| Conjugation | Unconjugated |
ACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration. Protocols Product Specific Protocols FC protocol for ACAP1 antibody 82967-4-RR Download protocol IF protocol for ACAP1 antibody 82967-4-RR Download protocol WB protocol for ACAP1 antibody 82967-4-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review