| Catalog Number | 10953-1-AP |
| Synonyms | High mobility group nucleosome-binding domain-containing protein 2, HMG17, Non-histone chromosomal protein HMG-17 |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP-MS, ELISA |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | K-562 cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | K-562 cells |
| Positive IHC detected in | human prostate cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1401 Product name: Recombinant human HMGN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC014644 Sequence: MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK Predict reactive species |
| Full Name | high-mobility group nucleosomal binding domain 2 |
| Calculated Molecular Weight | 9 aa, 3 kDa |
| Observed Molecular Weight | 18-20 kDa |
| GenBank Accession Number | BC014644 |
| Gene Symbol | HMGN2 |
| Gene ID (NCBI) | 3151 |
| RRID | AB_2118482 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05204 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| WB protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| IF protocol for HMGN2 antibody 10953-1-AP | Download protocol |
| mouse | IHC Cancer Biol Med Antitumor effects of STING agonists on nervous system tumors via tumor-intrinsic STING-STAT1-mediated HMGN2 expression. Authors - Zijian Lv View Article |
| human | WB,IP-MS Mol Med Rep HMGN2 induces pyroptosis in tumour cells by modulating the STT3B/PD‑L1/caspase‑1/GSDMD axis. Authors - Wenwen Han View Article |
| Citations | 9 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HMGN2 is a highly conserved nucleosomal protein which may involve in unfolding higher-order chromatin structure and facilitating the transcriptional activation of mammalian genes. It is the most abundant, ubiquitous and evolutionarily conserved nonhistione proteins found in the nuclei of higher eukaryotes. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. Protocols Product Specific Protocols IHC protocol for HMGN2 antibody 10953-1-AP Download protocol WB protocol for HMGN2 antibody 10953-1-AP Download protocol IF protocol for HMGN2 antibody 10953-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications