HNF1A Polyclonal antibody 22426-1-AP proteintech
$149.00
In stock
SKU
22426-1-AP
| Catalog Number | 22426-1-AP |
| Synonyms | Hepatocyte nuclear factor 1-alpha, HNF 1 alpha, HNF 1A, HNF1, HNF1 homeobox A |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ChIP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | rat liver tissue, SMMC-7721 cells, HuH-7 cells |
| Tested Applications — Positive IP detected in | mouse liver tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | rat liver tissue, SMMC-7721 cells, HuH-7 cells |
| Positive IP detected in | mouse liver tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18188 Product name: Recombinant human HNF1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-631 aa of BC104910 Sequence: PLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ Predict reactive species |
| Full Name | HNF1 homeobox A |
| Calculated Molecular Weight | 631 aa, 67 kDa |
| Observed Molecular Weight | 67 kDa |
| GenBank Accession Number | BC104910 |
| Gene Symbol | HNF1A |
| Gene ID (NCBI) | 6927 |
| RRID | AB_2879104 |
| Conjugate | Unconjugated |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P20823 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for HNF1A antibody 22426-1-AP | Download protocol |
| WB protocol for HNF1A antibody 22426-1-AP | Download protocol |
| human | WB,IHC,CoIP J Exp Clin Cancer Res ROS/PI3K/Akt and Wnt/β-catenin signalings activate HIF-1α-induced metabolic reprogramming to impart 5-fluorouracil resistance in colorectal cancer. Authors - Shuohui Dong View Article |
| rat | WB Acta Pharmacol Sin Aloe-emodin exerts cholesterol-lowering effects by inhibiting proprotein convertase subtilisin/kexin type 9 in hyperlipidemic rats. Authors - Zhen-Li Su View Article |
| Kamal (Verified Customer) (07-05-2023) | Works with 1X TBST for WB. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: Mouse Liver tissue |
| Citations | 18 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HNF-1 , a homoeprotein family designated the Hepatocyte Nuclear Factor family. The various HNF-1 isoforms regulate transcription of genes in the liver as well as in other tissues such as kidney, small intestine and thymus. HNF1 as a transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. It is required for the expression of several liver specific genes and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Protocols Product Specific Protocols IP protocol for HNF1A antibody 22426-1-AP Download protocol WB protocol for HNF1A antibody 22426-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Tissue-specific transcription reprogramming promotes liver metastasis of colorectal cancer.
Journal: Cell Res | Authors: Shuaishuai Teng | Species: human | Application: WB - The accessible promoter-mediated supplementary effect of host factors provides new insight into the tropism of SARS-CoV-2.
Journal: Mol Ther Nucleic Acids | Authors: Guifang Du | Species: human | Application: ChIP - Aloe-emodin exerts cholesterol-lowering effects by inhibiting proprotein convertase subtilisin/kexin type 9 in hyperlipidemic rats.
Journal: Acta Pharmacol Sin | Authors: Zhen-Li Su | Species: rat | Application: WB - 6-Formylindolo(3,2-b)carbazole induced aryl hydrocarbon receptor activation prevents intestinal barrier dysfunction through regulation of claudin-2 expression.
Journal: Chem Biol Interact | Authors: Yuanhang Ma KD Validated | Species: human | Application: WB - ROS/PI3K/Akt and Wnt/β-catenin signalings activate HIF-1α-induced metabolic reprogramming to impart 5-fluorouracil resistance in colorectal cancer.
Journal: J Exp Clin Cancer Res | Authors: Shuohui Dong | Species: human | Application: WB,IHC,CoIP - CBP/p300 HAT maintains the gene network critical for β cell identity and functional maturity.
Journal: Cell Death Dis | Authors: Linlin Zhang | Application: CoIP - OGT-enriched Hepatocyte-derived Extracellular Vesicles Promote Capillarization of Liver Sinusoidal Endothelial Cells in Metabolic Dysfunction-associated Steatotic Liver Disease.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Yanjin Wang | Species: human,mouse | Application: WB,IP,IF,ChIP - Chem-Stamp Empowered Discovery of a Novel ATRA-Based LDLR Up-Regulator for the Treatment of Atherosclerosis.
Journal: J Med Chem | Authors: Shanshan Wang - HNF1A induces glioblastoma by upregulating EPS8 and activating PI3K/AKT signaling pathway
Journal: Biochem Pharmacol | Authors: Gang Yang | Species: mouse,human | Application: WB,IHC - The accessible promoter-mediated supplementary effect of host factors provides new insight into the tropism of SARS-CoV-2.
Journal: Mol Ther Nucleic Acids | Authors: Guifang Du | Species: human | Application: ChIP - 6-Formylindolo(3,2-b)carbazole induced aryl hydrocarbon receptor activation prevents intestinal barrier dysfunction through regulation of claudin-2 expression.
Journal: Chem Biol Interact | Authors: Yuanhang Ma | Species: human | Application: WB - Impaired Hepatic Very Low-Density Lipoprotein Secretion Promotes Tumorigenesis and Is Accelerated with Fabp1 Deletion
Journal: Am J Pathol | Authors: Elizabeth P Newberry | Species: human | Application: WB - Effect of fucoidan on ethanol-induced liver injury and steatosis in mice and the underlying mechanism.
Journal: Food Nutr Res | Authors: Meilan Xue | Species: mouse | Application: WB - Dietary curcumin prevents hypercholesterolemia by inhibiting the transcriptional activity of SREBP-2 and HNF1α and reducing intestinal and hepatic NPC1L1 expression in high-fat diet-fed hamsters.
Journal: Nutr Metab (Lond) | Authors: Zhuo Cao | Species: human | Application: WB,IF - FTO mediates m6A demethylation of HNF1A and drives hepatic steatosis in metabolic dysfunction-associated steatotic liver disease.
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Jiaorong Tan | Species: human,mouse,rat | Application: WB,CoIP - SPOP inhibits HBV transcription and replication by ubiquitination and degradation of HNF1α
Journal: J Med Virol | Authors: Yubo Pi | Species: human | Application: WB - Hepatocyte nuclear factor 1 alpha (HNF1A) regulates transcription of O-GlcNAc transferase in a negative feedback mechanism.
Journal: FEBS Lett | Authors: Chuanhui Zhang | Species: human | Application: WB,chIP - 20( S )-Protopanaxatriol Improves Atherosclerosis by Inhibiting Low-Density Lipoprotein Receptor Degradation in ApoE KO Mice
Journal: J Cardiovasc Pharmacol | Authors: Ye-Wei Huang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
