HNRNPM Recombinant monoclonal antibody 85422-1-RR proteintech
$149.00
In stock
SKU
85422-1-RR
| Catalog Number | 85422-1-RR |
| Synonyms | 242883C3, hnRNP M, HNRNPM4, HNRPM, HNRPM4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, COLO 320 cells, MCF-7 cells |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Positive WB detected in | HeLa cells, HepG2 cells, COLO 320 cells, MCF-7 cells |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein M |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 73-77 kDa |
| GenBank Accession Number | BC000138 |
| Gene Symbol | HNRNPM |
| Gene ID (NCBI) | 4670 |
| RRID | AB_3744205 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P52272 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for HNRNPM antibody 85422-1-RR | Download protocol |
| WB protocol for HNRNPM antibody 85422-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IF/ICC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242883C3 |
| Conjugation | Unconjugated |
HNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists three isoforms MW range form 73 kDa and 77 kDa. Protocols Product Specific Protocols IF protocol for HNRNPM antibody 85422-1-RR Download protocol WB protocol for HNRNPM antibody 85422-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
