HOXA10 Recombinant monoclonal antibody 85951-2-RR proteintech
$149.00
In stock
SKU
85951-2-RR
| Catalog Number | 85951-2-RR |
| Synonyms | homeobox A10, Homeobox protein Hox 1H, Homeobox protein Hox A10, Homeobox protein Hox-1.8, Homeobox protein Hox-1H |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, U2OS cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive IF/ICC detected in | HeLa cells, U2OS cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag24156 Product name: Recombinant human HOXA10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-311 aa of BC013971 Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA Predict reactive species |
| Full Name | homeobox A10 |
| Calculated Molecular Weight | 393 aa, 41 kDa |
| GenBank Accession Number | BC013971 |
| Gene Symbol | HOXA10 |
| Gene ID (NCBI) | 3206 |
| RRID | AB_3744500 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P31260 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for HOXA10 antibody 85951-2-RR | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250418A12 |
| Conjugation | Unconjugated |
HOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone. Protocols Product Specific Protocols IF protocol for HOXA10 antibody 85951-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
