Cytochrome c Recombinant monoclonal antibody 83276-1-RR proteintech
$149.00
In stock
SKU
83276-1-RR
| Catalog Number | 83276-1-RR |
| Synonyms | 230503E10, CYC, CYCS |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse kidney tissue |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse kidney tissue |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag1455 Product name: Recombinant human Cytochrome c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species |
| Full Name | cytochrome c, somatic |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12-15 kDa |
| GenBank Accession Number | BC009578 |
| Gene Symbol | Cytochrome c |
| Gene ID (NCBI) | 54205 |
| RRID | AB_3670946 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P99999 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Cytochrome c antibody 83276-1-RR | Download protocol |
| IF protocol for Cytochrome c antibody 83276-1-RR | Download protocol |
| WB protocol for Cytochrome c antibody 83276-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IF/ICC : 1:200-1:800 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230503E10 |
| Conjugation | Unconjugated |
Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis. Protocols Product Specific Protocols FC protocol for Cytochrome c antibody 83276-1-RR Download protocol IF protocol for Cytochrome c antibody 83276-1-RR Download protocol WB protocol for Cytochrome c antibody 83276-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review